Recombinant Human UTP3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human UTP3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-479 of Human UTP3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVGRSRRRGAAKWAAVRAKAGPTLTDENGDDLGLPPSPGDTSYYQDQVDDFHEARSRAALAKGWNEVQSGDEEDGEEEEEEVLALDMDDEDDEDGGNAGEEEEEENADDDGGSSVQSEAEASVDPSLSWGQRKKLYYDTDYGSKSRGRQSQQEAEEEEREEEEEAQIIQRRLAQALQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESPELLELIEDLKVKLTEVKDELEPLLELVEQGIIPPGKGSQYLRTKYNLYLNYCSNISFYLILKARRVPAHGHPVIERLVTYRNLINKLSVVDQKLSSEIRHLLTLKDDAVKKELIPKAKSTKPKPKSVSKTSAAACAVTDLSDDSDFDEKAKLKYYKEIEDRQKLKRKKEENSTEEQALEDQNAKRAITYQIAKNRGLTPRRKKIDRNPRVKHREKFRRAKIRRRGQVREVRKEEQRYSGELSGIRAGVKKSIKLK

Protein/Peptide Type
Recombinant Protein
Gene
UTP3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UTP3 Protein

  • Charged amino acid-rich leucine zipper 1
  • CRL1charged amino acid rich leucine zipper 1 homolog
  • CRLZ1UTP3 homolog
  • disrupter of silencing 10
  • Disrupter of silencing SAS10
  • FLJ23256
  • SAS10DKFZp761F222
  • something about silencing protein 10
  • UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2769
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-16669
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-40840
Species: Hu, Mu
Applications: WB, IHC-P, IP
MAB1207
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-91269
Species: Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010438-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
AF5165
Species: Hu, Mu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2567
Species: Hu
Applications: WB, IHC-P, IP
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
MAB944
Species: Hu
Applications: WB, IHC

Publications for UTP3 Recombinant Protein (H00057050-P01) (0)

There are no publications for UTP3 Recombinant Protein (H00057050-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UTP3 Recombinant Protein (H00057050-P01) (0)

There are no reviews for UTP3 Recombinant Protein (H00057050-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UTP3 Recombinant Protein (H00057050-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UTP3 Products

Bioinformatics Tool for UTP3 Recombinant Protein (H00057050-P01)

Discover related pathways, diseases and genes to UTP3 Recombinant Protein (H00057050-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on UTP3

There are no specific blogs for UTP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF
UTP3 Antibody
NBP2-58960
p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UTP3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UTP3