USP47 Antibody - BSA Free

Western Blot: USP47 Antibody [NBP3-35557] - Western blot analysis of various lysates using USP47 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.

Immunohistochemistry: USP47 Antibody [NBP3-35557] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using USP47 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

USP47 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit USP47 Antibody - BSA Free (NBP3-35557) is a polyclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1128-1287 of human USP47 (NP_060414.3).
  
  Sequence:
  VEKMKSMSQLAVLSRRWKPSEMKLDPFQEVVLESSSVDELREKLSEISGIPLDDIEFAKGRGTFPCDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: USP47
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:200 - 1:2000
• Theoretical MW: 157 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for USP47 Antibody - BSA Free

• Deubiquitinating enzyme 47
• DKFZp686C13257
• EC 3.4.19.12
• FLJ20727
• Trf (TATA binding protein-related factor)-proximal homolog (Drosophila)
• Trf (TATA binding protein-related factor)-proximal homolog
• TRFP
• ubiquitin carboxyl-terminal hydrolase 47
• ubiquitin specific peptidase 47
• ubiquitin specific protease 47
• ubiquitin thioesterase 47
• Ubiquitin thiolesterase 47
• Ubiquitin-specific-processing protease 47
• USP47

Background

Ubiquitin (Ub) is a highly conserved protein found ubiquitously in eukaryotic organisms. The conjugation of ubiquitin to proteins is an important means to regulate protein activity for many cellular processes by tagging them for degradation. Removal of Ub can rescue proteins from degradation. This is accomplished by the ubiquitin-specific processing protease (UBP) family of enzymes. Ubiquitin specific peptidase (USP47) is a UBP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: USP47