USP4 Recombinant Protein Antigen

Images

 
There are currently no images for USP4 Protein (NBP1-86876PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

USP4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human USP4.

Source: E. coli

Amino Acid Sequence: NMVVADVYNHRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
USP4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86876.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for USP4 Recombinant Protein Antigen

  • Deubiquitinating enzyme 4
  • EC 3.1.2.15
  • EC 3.4.19.12
  • MGC149848
  • MGC149849
  • ubiquitin carboxyl-terminal esterase 4
  • ubiquitin carboxyl-terminal hydrolase 4
  • ubiquitin specific peptidase 4 (proto-oncogene)
  • ubiquitin specific protease 4 (proto-oncogene)
  • ubiquitin thioesterase 4
  • Ubiquitin thiolesterase 4
  • ubiquitin-specific processing protease 4
  • Ubiquitin-specific-processing protease 4
  • Ubiquitous nuclear protein homolog
  • UNP
  • Unph
  • UNPUnph
  • USP4

Background

Modification of target proteins by ubiquitin participates in a wide array of biological functions. Proteins destined for degradation or processing via the 26 S proteasome are coupled to multiple copies of ubiquitin. However, attachment of ubiquitin or ubiquitin-related molecules may also result in changes in subcellular distribution or modification of protein activity. An additional level of ubiquitin regulation, deubiquitination, is catalyzed by proteases called deubiquitinating enzymes, which fall into four distinct families. Ubiquitin C-terminal hydrolases, ubiquitin-specific processing proteases (USPs),1 OTU-domain ubiquitin-aldehyde-binding proteins, and Jab1/Pad1/MPN-domain-containing metallo-enzymes. Among these four families, USPs represent the most widespread and represented deubiquitinating enzymes across evolution. USPs tend to release ubiquitin from a conjugated protein. They display similar catalytic domains containing conserved Cys and His boxes but divergent N-terminal and occasionally C-terminal extensions, which are thought to function in substrate recognition, subcellular localization, and protein-protein interactions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86037
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00009958-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
NBP2-76350
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
NB100-513
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-33735
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-82455
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-26506
Species: Hu, Mu, Rt
Applications: B/N, In vitro
H00009266-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, S-ELISA, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
MAB3810
Species: Hu, Rt
Applications: ICC, Simple Western, WB
NBP1-87122
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00009097-M04
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
AF009
Species: Hu
Applications: IHC, WB
AF3025
Species: Hu
Applications: ELISA, ICC, WB
NBP1-86876PEP
Species: Hu
Applications: AC

Publications for USP4 Protein (NBP1-86876PEP) (0)

There are no publications for USP4 Protein (NBP1-86876PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP4 Protein (NBP1-86876PEP) (0)

There are no reviews for USP4 Protein (NBP1-86876PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for USP4 Protein (NBP1-86876PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional USP4 Products

Blogs on USP4

There are no specific blogs for USP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our USP4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol USP4