USP31 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: USP31 Antibody [NBP1-81430] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: USP31 Antibody [NBP1-81430] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

USP31 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LASLSESVEMTGERSEDDGGFSTRPFVRSVQRQSLSSRSSVTSPLAVNENCMRPSWSLSAKLQMRSNSPSRFSGDSPIHSSASTLEKIGEAADDKVSISCFGSLRNLSSSYQEPSD
Predicted Species
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP31
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
USP31 Protein (NBP1-81430PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for USP31 Antibody

  • Deubiquitinating enzyme 31
  • EC 3.1.2.15
  • EC 3.4.19.12
  • KIAA1203ubiquitin specific proteinase 31
  • ubiquitin carboxyl-terminal hydrolase 31
  • ubiquitin specific peptidase 31
  • ubiquitin specific protease 31
  • ubiquitin thioesterase 31
  • Ubiquitin thiolesterase 31
  • Ubiquitin-specific-processing protease 31

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
NB100-56173
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-86037
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB6322
Species: Hu
Applications: Neut, WB
H00001847-M04
Species: Hu, Rt
Applications: ELISA, ICC/IF, WB
640-A3
Species: Mu
Applications: Bind
NBP2-02665
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-55441
Species: Hu
Applications: WB
BC100-494
Species: Dr, Hu, Mu, Rb, Rt
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PEP-ELISA, PAGE, WB
NBP1-91499
Species: Bv, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84841
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56144
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-26506
Species: Hu, Mu, Rt
Applications: B/N, In vitro
NB600-225
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP1-81430
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for USP31 Antibody (NBP1-81430) (0)

There are no publications for USP31 Antibody (NBP1-81430).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP31 Antibody (NBP1-81430) (0)

There are no reviews for USP31 Antibody (NBP1-81430). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for USP31 Antibody (NBP1-81430) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional USP31 Products

Array NBP1-81430

Bioinformatics Tool for USP31 Antibody (NBP1-81430)

Discover related pathways, diseases and genes to USP31 Antibody (NBP1-81430). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP31 Antibody (NBP1-81430)

Discover more about diseases related to USP31 Antibody (NBP1-81430).
 

Pathways for USP31 Antibody (NBP1-81430)

View related products by pathway.

Blogs on USP31

There are no specific blogs for USP31, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP31 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP31