| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 90-200 of human USP13 (NP_003931.2). Sequence: MHLKRHVREKVRGASGGALPKRRNSKIFLDLDTDDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | USP13 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Optimal dilution of this antibody should be experimentally determined. |
| Storage | Store at 4C in the dark. |
| Buffer | PBS |
| Preservative | 0.05% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
|
Beclin 1: Regulator of Autophagy and Apoptosis Beclin 1 is the mammalian orthologue of the yeast Apg6/Vps30 gene. Beclin 1 can complement the defect in autophagy present in apg6 yeast strains and stimulate autophagy when overexpressed in mammalian cells (1) and can bind to Bcl2, an important regul... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | USP13 |