USAG1/SOSTDC1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: USAG1/SOSTDC1 Antibody [NBP3-17959] - Staining of human cell line RPTEC TERT1 shows localization to nucleoli rim & the Golgi apparatus.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

USAG1/SOSTDC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit USAG1/SOSTDC1 Antibody - BSA Free (NBP3-17959) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GYGTKYWSRRSSQEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNFESMSPAKPVQHHRERKRASKSSKHSMS
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SOSTDC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for USAG1/SOSTDC1 Antibody - BSA Free

• CDA019
• cystine-knot containing secreted protein
• DKFZp564D206
• Ectodermal BMP inhibitor
• Ectodin
• sclerostin domain containing 1
• sclerostin domain-containing protein 1
• SOSTDC1
• USAG1
• USAG-1
• USAG1uterine sensitization-associated protein-1
• Uterine sensitization-associated gene 1 protein
• WISE

Background

SOSTDC1 is a member of the sclerostin family and encodes an N-glycosylated, secreted protein with a C-terminal cystine knot-like domain. This protein functions as a bone morphogenetic protein (BMP) antagonist. Specifically, it directly associates with BMPs, prohibiting them from binding their receptors, thereby regulating BMP signaling during cellular proliferation, differentiation, and programmed cell death. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SOSTDC1