Recombinant Human Uroplakin Ib Protein

Images

 
SDS-Page: Recombinant Human Uroplakin Ib Protein [H00007348-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Uroplakin Ib Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 131-228 of Human UPK1B partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NNSPPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDWQKYTSAFRTENNDADYPWPRQCCVMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
UPK1B
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Uroplakin Ib Protein

  • tetraspanin-20
  • TSPAN20
  • tspan-20
  • TSPAN20tetraspan
  • UP1b
  • UPIB
  • UPK1
  • UPK1B
  • Uroplakin 1B
  • Uroplakin Ib
  • uroplakin-1b

Background

UPK1B - uroplakin 1B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38904
Species: Hu
Applications: Flow, IHC, IHC-P
NBP2-12482
Species: Hu
Applications: IHC, IHC-P
NBP2-14694
Species: Hu
Applications: IHC, IHC-P
NBP2-14694
Species: Hu
Applications: IHC, IHC-P
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-22187
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-42225
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, Func, ICC/IF, IP
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-65805
Species: Hu, Gt, Pm, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBL1-15012
Species: Hu
NBP1-88899
Species: Hu
Applications: IHC, IHC-P
MAB4624
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-86847
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00007348-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Uroplakin Ib Partial Recombinant Protein (H00007348-Q01) (0)

There are no publications for Uroplakin Ib Partial Recombinant Protein (H00007348-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Uroplakin Ib Partial Recombinant Protein (H00007348-Q01) (0)

There are no reviews for Uroplakin Ib Partial Recombinant Protein (H00007348-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Uroplakin Ib Partial Recombinant Protein (H00007348-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Uroplakin Ib Products

Bioinformatics Tool for Uroplakin Ib Partial Recombinant Protein (H00007348-Q01)

Discover related pathways, diseases and genes to Uroplakin Ib Partial Recombinant Protein (H00007348-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Uroplakin Ib Partial Recombinant Protein (H00007348-Q01)

Discover more about diseases related to Uroplakin Ib Partial Recombinant Protein (H00007348-Q01).
 

Pathways for Uroplakin Ib Partial Recombinant Protein (H00007348-Q01)

View related products by pathway.

PTMs for Uroplakin Ib Partial Recombinant Protein (H00007348-Q01)

Learn more about PTMs related to Uroplakin Ib Partial Recombinant Protein (H00007348-Q01).

Blogs on Uroplakin Ib

There are no specific blogs for Uroplakin Ib, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Uroplakin Ib Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UPK1B
Entrez