uPAR Antibody

Images

 
Immunohistochemistry-Paraffin: uPAR Antibody [NBP2-14711] - Staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: uPAR Antibody [NBP2-14711] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: uPAR Antibody [NBP2-14711] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: uPAR Antibody [NBP2-14711] - Staining of human skeletal muscle shows no cytoplasmic positivity as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

uPAR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQ GNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTH WIQEGE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLAUR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
uPAR Protein (NBP2-14711PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for uPAR Antibody

  • CD87 antigen
  • CD87
  • Monocyte activation antigen Mo3
  • plasminogen activator, urokinase receptor
  • PLAUR
  • uPAR
  • U-PAR
  • UPARurokinase plasminogen activator surface receptor
  • u-plasminogen activator receptor form 2
  • URKRMO3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1310
Species: Hu
Applications: WB, IHC, IP
NBP1-80633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-20866
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
MAB8550
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC, KO
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-07799
Species: Hu
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00005554-R02
Species: Hu

Publications for uPAR Antibody (NBP2-14711) (0)

There are no publications for uPAR Antibody (NBP2-14711).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for uPAR Antibody (NBP2-14711) (0)

There are no reviews for uPAR Antibody (NBP2-14711). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for uPAR Antibody (NBP2-14711) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional uPAR Products

Bioinformatics Tool for uPAR Antibody (NBP2-14711)

Discover related pathways, diseases and genes to uPAR Antibody (NBP2-14711). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for uPAR Antibody (NBP2-14711)

Discover more about diseases related to uPAR Antibody (NBP2-14711).
 

Pathways for uPAR Antibody (NBP2-14711)

View related products by pathway.

PTMs for uPAR Antibody (NBP2-14711)

Learn more about PTMs related to uPAR Antibody (NBP2-14711).

Blogs on uPAR

There are no specific blogs for uPAR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our uPAR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLAUR
Entrez