UNK Antibody - BSA Free

Analysis in human cell lines HEK293 and Caco-2 using Anti-UNK antibody. Corresponding UNK RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human colon shows weak cytoplasmic positivity in glandular cells.

Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu
• Applications: WB, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UNK Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit UNK Antibody - BSA Free (NBP1-89596) is a polyclonal antibody validated for use in IHC, WB and IP. Anti-UNK Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DAWKKEAEEAGERASAAGAECELAREQRDALEVQVKKLQEELERLHAGPEPQALPAFSDLEALSLSTLYSLQKQLRAHLEQVDKAVFHMQSVKCLKCQEQKRAVL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UNK
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Immunoprecipitation
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. IP, WB reactivity reported in (PMID: 26641712).
• Control Peptide:

  UNK Protein (NBP1-89596PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%). Mouse, Human reactivity reported in scientific literature (PMID: 25737280).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for UNK Antibody - BSA Free

• UNK unkempt homolog (Drosophila)
• ZC3H5
• ZC3HDC5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for UNK Antibody (NBP1-89596)(2)

Publications using NBP1-89596

• Jernej Murn, Marianna Teplova, Kathi Zarnack et al. Recognition of distinct RNA motifs by the clustered CCCH zinc fingers of neuronal protein Unkempt. Nature Structural & Molecular Biology 2015-12-07 [PMID: 26641712] (WB, IP, Human)
• Murn J, Zarnack K, Yang YJ et al. Control of a neuronal morphology program by an RNA-binding zinc finger protein, Unkempt. Genes Dev 2015-03-01 [PMID: 25737280] (Mouse, Human)

Bioinformatics

• Gene Symbol: UNK
• Uniprot:
  • Q9C0B0(Human)