UNK Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: UNK Antibody [NBP1-89595] - Staining of human cell line U-251 MG shows localization to cytosol & cytoplasmic bodies.
Immunohistochemistry-Paraffin: UNK Antibody [NBP1-89595] - Staining of human smooth muscle shows distinct cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UNK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IYKSTKCNDMQQSGSCPRGPFCAFAHVEQPPLSDDLQPSSAVSSPTQPGPVLYMPSAAGDSVPVSPSSPHAPDLSALLCRNSSLGSPSNLCGSPPGSIRKPPNLEGIVFPGES
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UNK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UNK Protein (NBP1-89595PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UNK Antibody

  • UNK unkempt homolog (Drosophila)
  • ZC3H5
  • ZC3HDC5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF1936
Species: Hu
Applications: WB, IP
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF993
Species: Mu
Applications: WB, IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
AF636
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89595
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for UNK Antibody (NBP1-89595) (0)

There are no publications for UNK Antibody (NBP1-89595).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UNK Antibody (NBP1-89595) (0)

There are no reviews for UNK Antibody (NBP1-89595). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for UNK Antibody (NBP1-89595) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UNK Products

UNK NBP1-89595

Bioinformatics Tool for UNK Antibody (NBP1-89595)

Discover related pathways, diseases and genes to UNK Antibody (NBP1-89595). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UNK Antibody (NBP1-89595)

Discover more about diseases related to UNK Antibody (NBP1-89595).
 

Pathways for UNK Antibody (NBP1-89595)

View related products by pathway.

PTMs for UNK Antibody (NBP1-89595)

Learn more about PTMs related to UNK Antibody (NBP1-89595).

Blogs on UNK

There are no specific blogs for UNK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UNK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UNK
Uniprot