UNC5H2/UNC5B Antibody - BSA Free

Immunohistochemistry-Paraffin: UNC5H2/UNC5B Antibody [NBP3-17778] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UNC5H2/UNC5B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SASLGSQQLLGLPRDPGSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSE
• Predicted Species: Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UNC5B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for UNC5H2/UNC5B Antibody - BSA Free

• P53RDL1
• p53-regulated receptor for death and life protein 1
• Protein unc-5 homolog 2
• Protein unc-5 homolog B
• transmembrane receptor Unc5H2
• unc5 (C.elegans homolog) b
• unc-5 homolog 2
• unc-5 homolog B (C. elegans)
• UNC5B
• UNC5H2
• UNC5H2netrin receptor UNC5B

Background

UNC5B - unc-5 homolog B (C. elegans)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UNC5B