UNC119 Antibody

Images

 
Western Blot: UNC119 Antibody [NBP1-81708] - Xenopus laevis retinal lysate (supernatant). A ~37 kda band was detected with the UNC119 antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: UNC119 Antibody [NBP1-81708] - Staining of human retina shows strong cytoplasmic positivity in photoreceptor cells and outer plexiform layer.
Western Blot: UNC119 Antibody [NBP1-81708] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more

Product Details

Summary
Reactivity Hu, Xp, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UNC119 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKI
Specificity
Specificity of human UNC119 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UNC119
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UNC119 Protein (NBP1-81708PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-81708 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UNC119 Antibody

  • hRG4
  • HRG4POC7 centriolar protein homolog A
  • POC7
  • POC7A
  • protein unc-119 homolog A
  • Retinal protein 4
  • RG4
  • unc119 (C.elegans) homolog
  • unc-119 homolog (C. elegans)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91680
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7500
Species: Hu
Applications: WB, ICC
NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP2-46542
Species: Hu
Applications: WB, IHC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-64843
Species: Mu
Applications: Flow, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-3104
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
NBP1-82549
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83543
Species: Hu
Applications: IHC, IHC-P
NB100-55735
Species: Hu, Mu, Bv, Ca, Ch, Pm
Applications: WB, ICC/IF, IP
NBP1-84974
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for UNC119 Antibody (NBP1-81708) (0)

There are no publications for UNC119 Antibody (NBP1-81708).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for UNC119 Antibody (NBP1-81708) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Xenopus laevis.

Reviews using NBP1-81708:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Xenopus laevis
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot UNC119 NBP1-81708
Enlarge
reviewed by:
Nycole Maza
WB Xenopus laevis 08/23/2018
View

Summary

ApplicationWestern Blot
Sample TestedX. laevis retina lysate
SpeciesXenopus laevis
LotR38267

Comments

CommentsUsed Unc119 antibody at 1:500 dilution. Goat anti-rabbit secondary antibody.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UNC119 Antibody (NBP1-81708) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for UNC119 Antibody (NBP1-81708)

Discover related pathways, diseases and genes to UNC119 Antibody (NBP1-81708). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UNC119 Antibody (NBP1-81708)

Discover more about diseases related to UNC119 Antibody (NBP1-81708).
 

Pathways for UNC119 Antibody (NBP1-81708)

View related products by pathway.

PTMs for UNC119 Antibody (NBP1-81708)

Learn more about PTMs related to UNC119 Antibody (NBP1-81708).
 

Research Areas for UNC119 Antibody (NBP1-81708)

Find related products by research area.

Blogs on UNC119

There are no specific blogs for UNC119, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Nycole Maza
08/23/2018
Application: WB
Species: Xenopus laevis

Bioinformatics

Gene Symbol UNC119