UNC119 Antibody - BSA Free

Western Blot: UNC119 Antibody [NBP1-81708] - Analysis in control (vector only transfected HEK293T lysate) and UNC119 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: UNC119 Antibody [NBP1-81708] - Staining of human retina shows moderate cytoplasmic positivity in photoreceptor cells and outer plexiform layer.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UNC119 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit UNC119 Antibody - BSA Free (NBP1-81708) is a polyclonal antibody validated for use in IHC and WB. Anti-UNC119 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKI
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UNC119
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  UNC119 Protein (NBP1-81708PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for UNC119 Antibody - BSA Free

• hRG4
• HRG4POC7 centriolar protein homolog A
• POC7
• POC7A
• protein unc-119 homolog A
• Retinal protein 4
• RG4
• unc119 (C.elegans) homolog
• unc-119 homolog (C. elegans)
• UNC119

Background

UNC119 is specifically expressed in the photoreceptors in the retina. The encoded product shares strong homology with the C. elegans unc119 protein and it can functionally complement the C. elegans unc119 mutation. It has been localized to the photoreceptor synapses in the outer plexiform layer of the retina, and suggested to play a role in the mechanism of photoreceptor neurotransmitter release through the synaptic vesicle cycle. Two transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for UNC119 Antibody (NBP1-81708)(1)

Publication using NBP1-81708

• Maza NA, Schiesser WE, Calvert PD An intrinsic compartmentalization code for peripheral membrane proteins in photoreceptor neurons J. Cell Biol. 2019-10-08 [PMID: 31594805]

Bioinformatics

• Gene Symbol: UNC119