UMODL1 Antibody - BSA Free

Western Blot: UMODL1 Antibody [NBP1-80535] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

UMODL1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human UMODL1. Peptide sequence EMQLFIGDSPIPQNYSVSASDDVRIEVGLYRQKSNLKVVLTECWATPSSN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UMODL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for UMODL1 Antibody - BSA Free

• uromodulin-like 1

Background

UMODL1 is a gene that codes for a protein expressed in the testis and fetal thymus that has four isoforms, with lengths of 1318, 1446, 1246, and 1374 amino acids and weights of approximately 144, 157, 137, and 149 kDa respectively. Current research is being done on diseases and disorders related to this gene including Kallmann syndrome, Down syndrome, myopia, hepatitis, prostatitis, and nueronitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UMODL1
• Uniprot:
  • NP_001004416(Human)