TRIM61 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TRIM61 Antibody [NBP2-13485] - Staining of human cell line U-2 OS shows localization to nucleoli fibrillar center & endoplasmic reticulum.
Immunohistochemistry-Paraffin: TRIM61 Antibody [NBP2-13485] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIM61 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KLEEYNAPWKERVELIEKVITMQTRKSLELKKKMESPSV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM61
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRIM61 Protein (NBP2-13485PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIM61 Antibody

  • FLJ60274
  • putative tripartite motif-containing protein 61
  • RING finger protein 35MGC102996
  • RNF35
  • tripartite motif containing 61
  • tripartite motif-containing 61

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-80535
Species: Hu
Applications: WB
NBP1-83494
Species: Hu
Applications: IHC, IHC-P
NBP1-76279
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC
NB100-448
Species: Hu, Mu, Ca, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC
MAB342
Species: Hu
Applications: WB, AgAct
NBP2-56883
Species: Hu
Applications: ICC/IF
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-13464
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
5096-BM
Species: Hu
NBP1-86241
Species: Hu
Applications: WB, IHC, IHC-P
AF2250
Species: Hu
Applications: WB, IHC
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP2-13485
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TRIM61 Antibody (NBP2-13485) (0)

There are no publications for TRIM61 Antibody (NBP2-13485).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM61 Antibody (NBP2-13485) (0)

There are no reviews for TRIM61 Antibody (NBP2-13485). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TRIM61 Antibody (NBP2-13485) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIM61 Products

Bioinformatics Tool for TRIM61 Antibody (NBP2-13485)

Discover related pathways, diseases and genes to TRIM61 Antibody (NBP2-13485). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM61 Antibody (NBP2-13485)

Discover more about diseases related to TRIM61 Antibody (NBP2-13485).
 

Pathways for TRIM61 Antibody (NBP2-13485)

View related products by pathway.

Research Areas for TRIM61 Antibody (NBP2-13485)

Find related products by research area.

Blogs on TRIM61

There are no specific blogs for TRIM61, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM61 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM61