TOX2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TOX2 Antibody [NBP2-13464] - Staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
Immunohistochemistry-Paraffin: TOX2 Antibody [NBP2-13464] - Staining of human tonsil shows moderate nuclear positivity in germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

TOX2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IAGVFPQKFDGDSAYVGMSDGNPELLSTSQTYNGQSENNEDYEIPPITPP N
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOX2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
TOX2 Protein (NBP2-13464PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (80%)

Alternate Names for TOX2 Antibody

  • C20orf100
  • chromosome 20 open reading frame 100
  • dJ495O3.1
  • GCX1
  • GCX-1dJ1108D11.2
  • granulosa cell HMG box 1
  • Granulosa cell HMG box protein 1
  • granulosa cell HMG-box protein 1
  • MGC15880
  • TOX high mobility group box family member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13391
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86676
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP2-38102
Species: Hu
Applications: IHC, IHC-P
NBP1-92530
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-92756
Species: Hu, Mu, Ch, Re
Applications: WB
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87857
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84754
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB342
Species: Hu
Applications: WB, Flow, AgAct
NBP1-56454
Species: Hu
Applications: WB
NBP1-67769
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP2-24867
Species: Hu
Applications: Flow, Func, In vitro, In vivo, Flow-CS
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00391712-A01
Species: Hu
Applications: WB, ELISA
NBP1-88433
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13464
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TOX2 Antibody (NBP2-13464) (0)

There are no publications for TOX2 Antibody (NBP2-13464).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOX2 Antibody (NBP2-13464) (0)

There are no reviews for TOX2 Antibody (NBP2-13464). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TOX2 Antibody (NBP2-13464) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TOX2 Antibody Products

Related Products by Gene

Bioinformatics Tool for TOX2 Antibody (NBP2-13464)

Discover related pathways, diseases and genes to TOX2 Antibody (NBP2-13464). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOX2 Antibody (NBP2-13464)

Discover more about diseases related to TOX2 Antibody (NBP2-13464).
 

Pathways for TOX2 Antibody (NBP2-13464)

View related products by pathway.

PTMs for TOX2 Antibody (NBP2-13464)

Learn more about PTMs related to TOX2 Antibody (NBP2-13464).

Blogs on TOX2

There are no specific blogs for TOX2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol TOX2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-13464 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought