TOX2 Antibody


Immunocytochemistry/ Immunofluorescence: TOX2 Antibody [NBP2-13464] - Staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
Immunohistochemistry-Paraffin: TOX2 Antibody [NBP2-13464] - Staining of human tonsil shows moderate nuclear positivity in germinal center cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

TOX2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: IAGVFPQKFDGDSAYVGMSDGNPELLSTSQTYNGQSENNEDYEIPPITPP N
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
TOX2 Protein (NBP2-13464PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (80%)

Alternate Names for TOX2 Antibody

  • C20orf100
  • chromosome 20 open reading frame 100
  • dJ495O3.1
  • GCX1
  • GCX-1dJ1108D11.2
  • granulosa cell HMG box 1
  • Granulosa cell HMG box protein 1
  • granulosa cell HMG-box protein 1
  • MGC15880
  • TOX high mobility group box family member 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ch, Re
Applications: WB
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, AgAct, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
Species: Hu
Applications: Flow, Func, In vitro, In vivo, Flow-CS
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TOX2 Antibody (NBP2-13464) (0)

There are no publications for TOX2 Antibody (NBP2-13464).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOX2 Antibody (NBP2-13464) (0)

There are no reviews for TOX2 Antibody (NBP2-13464). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TOX2 Antibody (NBP2-13464) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TOX2 Antibody Products

Related Products by Gene

Bioinformatics Tool for TOX2 Antibody (NBP2-13464)

Discover related pathways, diseases and genes to TOX2 Antibody (NBP2-13464). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOX2 Antibody (NBP2-13464)

Discover more about diseases related to TOX2 Antibody (NBP2-13464).

Pathways for TOX2 Antibody (NBP2-13464)

View related products by pathway.

PTMs for TOX2 Antibody (NBP2-13464)

Learn more about PTMs related to TOX2 Antibody (NBP2-13464).

Blogs on TOX2

There are no specific blogs for TOX2, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our TOX2 Antibody and receive a gift card or discount.


Gene Symbol TOX2

Customers Who Bought This Also Bought