TOX2 Antibody - BSA Free

Immunohistochemistry-Paraffin: TOX2 Antibody [NBP2-13464] - Staining in human lymph node and skeletal muscle tissues.. Corresponding TOX2 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: TOX2 Antibody [NBP2-13464] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TOX2 Antibody [NBP2-13464] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: TOX2 Antibody [NBP2-13464] - Staining of human lymph node shows strong nuclear positivity in germinal center cells.

Immunohistochemistry-Paraffin: TOX2 Antibody [NBP2-13464] - Staining of human tonsil shows strong nuclear positivity in germinal center cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TOX2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: IAGVFPQKFDGDSAYVGMSDGNPELLSTSQTYNGQSENNEDYEIPPITPPN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TOX2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TOX2 Protein (NBP2-13464PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TOX2 Antibody - BSA Free

• C20orf100
• chromosome 20 open reading frame 100
• dJ495O3.1
• GCX1
• GCX-1dJ1108D11.2
• granulosa cell HMG box 1
• Granulosa cell HMG box protein 1
• granulosa cell HMG-box protein 1
• MGC15880
• TOX high mobility group box family member 2

Background

Putative transcriptional activator involved in the hypothalamo-pituitary-gonadal system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TOX2