UGT3A2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: UGT3A2 Antibody [NBP2-32468] - Staining of human cell line SH-SY5Y shows localization to nucleus, cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: UGT3A2 Antibody [NBP2-32468] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UGT3A2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IPLFGDQPENMVRVEAKKFGVSIQLKKLKAETLALKMKQIM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UGT3A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UGT3A2 Protein (NBP2-32468PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UGT3A2 Antibody

  • EC 2.4.1.17
  • MGC119426
  • MGC119429
  • UDP glycosyltransferase 3 family, polypeptide A2
  • UDP-glucuronosyltransferase 3A2
  • UDPGT 3A2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31025
Species: Hu
Applications: IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00054600-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
AF6490
Species: Hu
Applications: WB, IHC, ICC
NBP1-62660
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33743
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-13318
Species: Hu
Applications: IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
H00001836-M04
Species: Hu
Applications: WB, ELISA
NBP2-57222
Species: Hu
Applications: ICC/IF
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87909
Species: Hu
Applications: IHC, IHC-P
NBP2-32468
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for UGT3A2 Antibody (NBP2-32468) (0)

There are no publications for UGT3A2 Antibody (NBP2-32468).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGT3A2 Antibody (NBP2-32468) (0)

There are no reviews for UGT3A2 Antibody (NBP2-32468). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for UGT3A2 Antibody (NBP2-32468) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UGT3A2 Products

Bioinformatics Tool for UGT3A2 Antibody (NBP2-32468)

Discover related pathways, diseases and genes to UGT3A2 Antibody (NBP2-32468). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGT3A2 Antibody (NBP2-32468)

Discover more about diseases related to UGT3A2 Antibody (NBP2-32468).
 

Pathways for UGT3A2 Antibody (NBP2-32468)

View related products by pathway.

Research Areas for UGT3A2 Antibody (NBP2-32468)

Find related products by research area.

Blogs on UGT3A2

There are no specific blogs for UGT3A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UGT3A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UGT3A2