UGT3A2 Antibody


Immunocytochemistry/ Immunofluorescence: UGT3A2 Antibody [NBP2-32468] - Staining of human cell line SH-SY5Y shows localization to nucleus, cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: UGT3A2 Antibody [NBP2-32468] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

UGT3A2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: IPLFGDQPENMVRVEAKKFGVSIQLKKLKAETLALKMKQIM
Specificity of human UGT3A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UGT3A2 Protein (NBP2-32468PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for UGT3A2 Antibody

  • EC
  • MGC119426
  • MGC119429
  • UDP glycosyltransferase 3 family, polypeptide A2
  • UDP-glucuronosyltransferase 3A2
  • UDPGT 3A2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for UGT3A2 Antibody (NBP2-32468) (0)

There are no publications for UGT3A2 Antibody (NBP2-32468).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGT3A2 Antibody (NBP2-32468) (0)

There are no reviews for UGT3A2 Antibody (NBP2-32468). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for UGT3A2 Antibody (NBP2-32468) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional UGT3A2 Products

Bioinformatics Tool for UGT3A2 Antibody (NBP2-32468)

Discover related pathways, diseases and genes to UGT3A2 Antibody (NBP2-32468). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGT3A2 Antibody (NBP2-32468)

Discover more about diseases related to UGT3A2 Antibody (NBP2-32468).

Pathways for UGT3A2 Antibody (NBP2-32468)

View related products by pathway.

Research Areas for UGT3A2 Antibody (NBP2-32468)

Find related products by research area.

Blogs on UGT3A2

There are no specific blogs for UGT3A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our UGT3A2 Antibody and receive a gift card or discount.


Gene Symbol UGT3A2