SLC23A1 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC23A1 Antibody [NBP2-13318] - Staining of human pancreas shows no positivity as expected.

Immunohistochemistry-Paraffin: SLC23A1 Antibody [NBP2-13318] - Staining of human kidney shows strong membranous positivity in cells in tubules.

Immunohistochemistry-Paraffin: SLC23A1 Antibody [NBP2-13318] - Staining of human small intestine shows strong positivity in luminal membrane in glandular cells.

Immunohistochemistry-Paraffin: SLC23A1 Antibody [NBP2-13318] - Staining of human fallopian tube shows moderate to strong positivity in apical membrane of ciliated cells.

Analysis in human small intestine and pancreas tissues using NBP2-13318 antibody. Corresponding SLC23A1 RNA-seq data are presented for the same tissues.

Staining of human kidney shows moderate to strong positivity in apical membrane in cells in tubules.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC23A1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC23A1 Antibody - BSA Free (NBP2-13318) is a polyclonal antibody validated for use in IHC and WB. Anti-SLC23A1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: NTVPGSPEERGLIQWKAGAHANSDMSSSLKSYDFPIGMGIVKRITFLKYIPICPVFKGFSSSSKDQIAIPEDTPENTETAS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC23A1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reported in the scientific literature (PMID: 30285481).
• Control Peptide:

  SLC23A1 Protein (NBP2-13318PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC23A1 Antibody - BSA Free

• hSVCT1
• SLC23A2
• Sodium-dependent vitamin C transporter 1
• sodium-dependent vitamin C transporter-1
• solute carrier family 23 (nucleobase transporters), member 1
• solute carrier family 23 (nucleobase transporters), member 2
• solute carrier family 23 member 1
• SVCT1Na(+)/L-ascorbic acid transporter 1
• Yolk sac permease-like molecule 3
• YSPL3MGC22361

Background

The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two transporters. The encoded protein is active in bulk vitamin C transport involving epithelial surfaces. Previously, this gene had an official symbol of SLC23A2. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC23A1 Antibody (NBP2-13318)(3)

Publications using NBP2-13318

• Qin S, Wang G, Chen L et al. Pharmacological vitamin C inhibits mTOR signaling and tumor growth by degrading Rictor and inducing HMOX1 expression PLoS genetics 2023-02-01 [PMID: 36787291] (WB, Human)
• Subramenium GA, Subai S, Marchant JS et al. Enterotoxigenic Escherichia coli (ETEC) heat labile enterotoxin inhibits intestinal ascorbic acid uptake via a cAMP-dependent NF-kB mediated pathway. Am. J. Physiol. Gastrointest. Liver Physiol. 2018-10-04 [PMID: 30285481] (WB, Human)
• Romo D, Velmurugan K, Upham BL et al. Expression and Clinicopathological Implications of the Vitamin C Transporters SVCT-1 and SVCT-2 in Colon Cancer Thesis (IHC-P, Human)

Bioinformatics

• Gene Symbol: SLC23A1