SLC23A1 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC23A1 Antibody [NBP2-13318] - Staining of human pancreas shows no positivity as expected.
Immunohistochemistry-Paraffin: SLC23A1 Antibody [NBP2-13318] - Staining of human kidney shows strong membranous positivity in cells in tubules.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SLC23A1 Antibody [NBP2-13318] - Analysis in human small intestine and pancreas tissues. Corresponding SLC23A1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC23A1 Antibody [NBP2-13318] - Staining of human small intestine shows strong positivity in luminal membrane in glandular cells.
Immunohistochemistry-Paraffin: SLC23A1 Antibody [NBP2-13318] - Staining of human fallopian tube shows moderate to strong positivity in apical membrane of ciliated cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SLC23A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NTVPGSPEERGLIQWKAGAHANSDMSSSLKSYDFPIGMGIVKRITFLKYI PICPVFKGFSSSSKDQIAIPEDTPENTETAS
Specificity
Specificity of human SLC23A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC23A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reported in the scientific literature (PMID: 30285481).
Control Peptide
SLC23A1 Protein (NBP2-13318PEP)
Publications
Read Publications using
NBP2-13318 in the following applications:

  • 1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC23A1 Antibody

  • hSVCT1
  • SLC23A2
  • Sodium-dependent vitamin C transporter 1
  • sodium-dependent vitamin C transporter-1
  • solute carrier family 23 (nucleobase transporters), member 1
  • solute carrier family 23 (nucleobase transporters), member 2
  • solute carrier family 23 member 1
  • SVCT1Na(+)/L-ascorbic acid transporter 1
  • Yolk sac permease-like molecule 3
  • YSPL3MGC22361

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94035
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC
NB110-39113
Species: Hu, Mu, Rt, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Flow-IC
NBP2-66872
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-59896
Species: Hu
Applications: WB
NBP1-49533
Species: Hu, Mu, Rt, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
DPSG10
Species: Hu
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-13318
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SLC23A1 Antibody (NBP2-13318)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC-P, WB.


Filter By Application
IHC-P
(1)
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP2-13318 Applications Species
Subramenium GA, Subai S, Marchant JS et al. Enterotoxigenic Escherichia coli (ETEC) heat labile enterotoxin inhibits intestinal ascorbic acid uptake via a cAMP-dependent NF-kB mediated pathway. Am. J. Physiol. Gastrointest. Liver Physiol. Oct 4 2018 [PMID: 30285481] (WB, Human) WB Human
Romo D, Velmurugan K, Upham BL et al. Expression and Clinicopathological Implications of the Vitamin C Transporters SVCT-1 and SVCT-2 in Colon Cancer Thesis (IHC-P, Human) IHC-P Human

Reviews for SLC23A1 Antibody (NBP2-13318) (0)

There are no reviews for SLC23A1 Antibody (NBP2-13318). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC23A1 Antibody (NBP2-13318) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC23A1 Products

Bioinformatics Tool for SLC23A1 Antibody (NBP2-13318)

Discover related pathways, diseases and genes to SLC23A1 Antibody (NBP2-13318). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC23A1 Antibody (NBP2-13318)

Discover more about diseases related to SLC23A1 Antibody (NBP2-13318).
 

Pathways for SLC23A1 Antibody (NBP2-13318)

View related products by pathway.

PTMs for SLC23A1 Antibody (NBP2-13318)

Learn more about PTMs related to SLC23A1 Antibody (NBP2-13318).

Blogs on SLC23A1

There are no specific blogs for SLC23A1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC23A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC23A1