UGT3A2 Antibody


Western Blot: UGT3A2 Antibody [NBP1-69421] - This Anti-UGT3A2 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 2.5ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

UGT3A2 Antibody Summary

Synthetic peptides corresponding to UGT3A2(UDP glycosyltransferase 3 family, polypeptide A2) The peptide sequence was selected from the N terminal of UGT3A2. Peptide sequence HNVTMLNHKRGPFMPDFKKEEKSYQVISWLAPEDHQREFKKSFDFFLEET.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against UGT3A2 and was validated on Western blot.
Theoretical MW
59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UGT3A2 Antibody

  • EC
  • MGC119426
  • MGC119429
  • UDP glycosyltransferase 3 family, polypeptide A2
  • UDP-glucuronosyltransferase 3A2
  • UDPGT 3A2


UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: WB

Publications for UGT3A2 Antibody (NBP1-69421) (0)

There are no publications for UGT3A2 Antibody (NBP1-69421).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGT3A2 Antibody (NBP1-69421) (0)

There are no reviews for UGT3A2 Antibody (NBP1-69421). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGT3A2 Antibody (NBP1-69421) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional UGT3A2 Products

Bioinformatics Tool for UGT3A2 Antibody (NBP1-69421)

Discover related pathways, diseases and genes to UGT3A2 Antibody (NBP1-69421). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGT3A2 Antibody (NBP1-69421)

Discover more about diseases related to UGT3A2 Antibody (NBP1-69421).

Pathways for UGT3A2 Antibody (NBP1-69421)

View related products by pathway.

Research Areas for UGT3A2 Antibody (NBP1-69421)

Find related products by research area.

Blogs on UGT3A2

There are no specific blogs for UGT3A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our UGT3A2 Antibody and receive a gift card or discount.


Gene Symbol UGT3A2