UGT2B4 Antibody

Images

 
Western Blot: UGT2B4 Antibody [NBP1-69604] - This Anti-UGT2B4 antibody was used in Western Blot of Fetal Lung tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UGT2B4 Antibody Summary

Immunogen
Synthetic peptides corresponding to UGT2B4(UDP glucuronosyltransferase 2 family, polypeptide B4) The peptide sequence was selected from the N terminal of UGT2B4. Peptide sequence NIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UGT2B4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against UGT2B4 and was validated on Western blot.
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UGT2B4 Antibody

  • family 2, beta-4
  • UDP glucuronosyltransferase 2 family, polypeptide B4
  • UDP glycosyltransferase 2 family, polypeptide B4

Background

UGT2B4 belongs to the UDP-glycosyltransferase family. UDPGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isozyme is active on polyhydroxylated estrogens (such as estriol, 4-hydroxyestrone and 2-hydroxyestriol) and xenobiotics (such as 4-methylumbelliferone, 1-naphthol, 4-nitrophenol, 2-aminophenol, 4-hydroxybiphenyl and menthol). It is capable of 6 alpha-hydroxyglucuronidation of hyodeoxycholic acid.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007364-M02-100ug
Species: Hu, Rt
Applications: WB, ELISA
AF6490
Species: Hu
Applications: WB, IHC, ICC
H00054600-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
H00007366-B01P
Species: Hu
Applications: WB
NBP1-69412
Species: Hu
Applications: WB
NBP1-33743
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00054659-M02
Species: Hu
Applications: WB, ELISA
NBP1-72063
Species: Rt
Applications: WB, PEP-ELISA
NBP2-06724
Species: Hu
NBP2-08443
Species: Hu
NBP1-91335
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-59786
Species: Hu
Applications: WB
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP1-91818
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA

Publications for UGT2B4 Antibody (NBP1-69604) (0)

There are no publications for UGT2B4 Antibody (NBP1-69604).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGT2B4 Antibody (NBP1-69604) (0)

There are no reviews for UGT2B4 Antibody (NBP1-69604). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGT2B4 Antibody (NBP1-69604) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UGT2B4 Products

Bioinformatics Tool for UGT2B4 Antibody (NBP1-69604)

Discover related pathways, diseases and genes to UGT2B4 Antibody (NBP1-69604). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGT2B4 Antibody (NBP1-69604)

Discover more about diseases related to UGT2B4 Antibody (NBP1-69604).
 

Pathways for UGT2B4 Antibody (NBP1-69604)

View related products by pathway.

PTMs for UGT2B4 Antibody (NBP1-69604)

Learn more about PTMs related to UGT2B4 Antibody (NBP1-69604).

Blogs on UGT2B4

There are no specific blogs for UGT2B4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UGT2B4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UGT2B4
Uniprot