UGT2B4 Antibody


Western Blot: UGT2B4 Antibody [NBP1-69604] - This Anti-UGT2B4 antibody was used in Western Blot of Fetal Lung tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC

Order Details

UGT2B4 Antibody Summary

Synthetic peptides corresponding to UGT2B4(UDP glucuronosyltransferase 2 family, polypeptide B4) The peptide sequence was selected from the N terminal of UGT2B4. Peptide sequence NIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against UGT2B4 and was validated on Western blot.
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UGT2B4 Antibody

  • family 2, beta-4
  • UDP glucuronosyltransferase 2 family, polypeptide B4
  • UDP glycosyltransferase 2 family, polypeptide B4


UGT2B4 belongs to the UDP-glycosyltransferase family. UDPGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isozyme is active on polyhydroxylated estrogens (such as estriol, 4-hydroxyestrone and 2-hydroxyestriol) and xenobiotics (such as 4-methylumbelliferone, 1-naphthol, 4-nitrophenol, 2-aminophenol, 4-hydroxybiphenyl and menthol). It is capable of 6 alpha-hydroxyglucuronidation of hyodeoxycholic acid.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Rt
Applications: WB, PEP-ELISA
Species: Hu
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA

Publications for UGT2B4 Antibody (NBP1-69604) (0)

There are no publications for UGT2B4 Antibody (NBP1-69604).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGT2B4 Antibody (NBP1-69604) (0)

There are no reviews for UGT2B4 Antibody (NBP1-69604). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGT2B4 Antibody (NBP1-69604) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional UGT2B4 Products

Bioinformatics Tool for UGT2B4 Antibody (NBP1-69604)

Discover related pathways, diseases and genes to UGT2B4 Antibody (NBP1-69604). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGT2B4 Antibody (NBP1-69604)

Discover more about diseases related to UGT2B4 Antibody (NBP1-69604).

Pathways for UGT2B4 Antibody (NBP1-69604)

View related products by pathway.

PTMs for UGT2B4 Antibody (NBP1-69604)

Learn more about PTMs related to UGT2B4 Antibody (NBP1-69604).

Blogs on UGT2B4

There are no specific blogs for UGT2B4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our UGT2B4 Antibody and receive a gift card or discount.


Gene Symbol UGT2B4