UGT2A3 Antibody


Western Blot: UGT2A3 Antibody [NBP1-69358] - This Anti-UGT2A3 antibody was used in Western Blot of NTERA2 tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB

Order Details

UGT2A3 Antibody Summary

Synthetic peptides corresponding to UGT2A3(UDP glucuronosyltransferase 2 family, polypeptide A3) The peptide sequence was selected from the middle region of UGT2A3. Peptide sequence GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANTR.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against UGT2A3 and was validated on Western blot.
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UGT2A3 Antibody

  • EC
  • FLJ21934
  • UDP glucuronosyltransferase 2 family, polypeptide A3
  • UDP-glucuronosyltransferase 2A3
  • UDPGT 2A3


UGT2A3 belongs to the UDP-glycosyltransferase family. UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB, IP, PLA
Species: Mu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB

Publications for UGT2A3 Antibody (NBP1-69358) (0)

There are no publications for UGT2A3 Antibody (NBP1-69358).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGT2A3 Antibody (NBP1-69358) (0)

There are no reviews for UGT2A3 Antibody (NBP1-69358). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGT2A3 Antibody (NBP1-69358) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional UGT2A3 Products

UGT2A3 NBP1-69358

Bioinformatics Tool for UGT2A3 Antibody (NBP1-69358)

Discover related pathways, diseases and genes to UGT2A3 Antibody (NBP1-69358). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGT2A3 Antibody (NBP1-69358)

Discover more about diseases related to UGT2A3 Antibody (NBP1-69358).

Pathways for UGT2A3 Antibody (NBP1-69358)

View related products by pathway.

PTMs for UGT2A3 Antibody (NBP1-69358)

Learn more about PTMs related to UGT2A3 Antibody (NBP1-69358).

Research Areas for UGT2A3 Antibody (NBP1-69358)

Find related products by research area.

Blogs on UGT2A3

There are no specific blogs for UGT2A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our UGT2A3 Antibody and receive a gift card or discount.


Gene Symbol UGT2A3