UCP4 Recombinant Protein Antigen

Images

 
There are currently no images for UCP4 Recombinant Protein Antigen (NBP2-57763PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

UCP4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UCP4.

Source: E. coli

Amino Acid Sequence: MQGEAALARLGDGARESAPYRGMVRTALGIIEEEGFL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC25A27
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57763.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for UCP4 Recombinant Protein Antigen

  • FLJ33552
  • mitochondrial uncoupling protein 4
  • Solute carrier family 25 member 27
  • solute carrier family 25, member 27
  • UCP 4
  • UCP4uncoupling protein 4

Background

Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. Transcripts of this gene are only detected in brain tissue and are specifically modulated by various environmental conditions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59598
Species: Hu, Mu
Applications: IHC, WB
NB100-59742
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, PEP-ELISA, WB
MAB6158
Species: Hu, Mu
Applications: ICC, ICFlow, Simple Western, WB
NBP2-24608
Species: Hu, Mu, Pm, Rt
Applications: WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-45626
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-1607
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB300-270
Species: Ch, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, In vitro, Simple Western, WB
NBP2-19388
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DLP00
Species: Hu
Applications: ELISA
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
AF1457
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-87436
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-55288
Species: Fi, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB

Publications for UCP4 Recombinant Protein Antigen (NBP2-57763PEP) (0)

There are no publications for UCP4 Recombinant Protein Antigen (NBP2-57763PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UCP4 Recombinant Protein Antigen (NBP2-57763PEP) (0)

There are no reviews for UCP4 Recombinant Protein Antigen (NBP2-57763PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for UCP4 Recombinant Protein Antigen (NBP2-57763PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UCP4 Products

Research Areas for UCP4 Recombinant Protein Antigen (NBP2-57763PEP)

Find related products by research area.

Blogs on UCP4

There are no specific blogs for UCP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our UCP4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A27