UCK2 Antibody

Images

 
Western Blot: UCK2 Antibody [H00007371-B01P] - Analysis of UCK2 expression in transfected 293T cell line by UCK2 polyclonal antibody. Lane 1: UCK2 transfected lysate(28.71 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UCK2 Antibody Summary

Immunogen
UCK2 (NP_036606.2, 1 a.a. - 261 a.a.) full-length human protein. MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPH
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
UCK2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UCK2 Antibody

  • Cytidine monophosphokinase 2
  • DKFZp686M04245
  • EC 2.7.1.48
  • Testis-specific protein TSA903
  • TSA903
  • UCK 2
  • UK
  • UMPK
  • uridine kinase
  • uridine monophosphate kinase
  • Uridine monophosphokinase 2
  • uridine-cytidine kinase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85896
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46313
Species: Hu, Mk
Applications: WB, IHC, IF
NBP2-43639
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-47587
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
H00001806-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-57516
Species: Hu
Applications: WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24750
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P

Publications for UCK2 Antibody (H00007371-B01P) (0)

There are no publications for UCK2 Antibody (H00007371-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UCK2 Antibody (H00007371-B01P) (0)

There are no reviews for UCK2 Antibody (H00007371-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UCK2 Antibody (H00007371-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UCK2 Products

Bioinformatics Tool for UCK2 Antibody (H00007371-B01P)

Discover related pathways, diseases and genes to UCK2 Antibody (H00007371-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UCK2 Antibody (H00007371-B01P)

Discover more about diseases related to UCK2 Antibody (H00007371-B01P).
 

Pathways for UCK2 Antibody (H00007371-B01P)

View related products by pathway.

PTMs for UCK2 Antibody (H00007371-B01P)

Learn more about PTMs related to UCK2 Antibody (H00007371-B01P).

Blogs on UCK2

There are no specific blogs for UCK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UCK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UCK2
Uniprot