UCK Antibody - BSA Free

Western Blot: UCK Antibody [NBP2-47587] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.

Immunocytochemistry/Immunofluorescence: UCK Antibody [NBP2-47587] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: UCK Antibody [NBP2-47587] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: UCK Antibody [NBP2-47587] - Staining of human cerebral cortex shows moderate nuclear and weak cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: UCK Antibody [NBP2-47587] - Staining of human fallopian tube shows moderate nuclear and weak cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: UCK Antibody [NBP2-47587] - Staining of human kidney shows strong nuclear and moderate cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UCK Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit UCK Antibody - BSA Free (NBP2-47587) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IQDILNGDICKWHRGGSNGRSYKRTFSEPGDHPGMLTSGKRSHLESSSRP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UCK1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  UCK Protein (NBP2-47587PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for UCK Antibody - BSA Free

• Cytidine monophosphokinase 1
• EC 2.7.1.48
• FLJ12255
• Uridine monophosphokinase 1
• uridine-cytidine kinase 1
• URK1UCK 1

Background

UCK1 - uridine-cytidine kinase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UCK1