UBR5/EDD Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: UBR5/EDD Antibody [NBP2-58579] - Staining of human cell line MCF7 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UBR5/EDD Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GSTSKEGEPNLDKKNTPVQSPVSLGEDLQWWPDKDGTKFICIGALYSELLAVSSKGELYQWKWSESEPYRNAQNPSLHHPRATFLGLTNEKI
Specificity
Specificity of human UBR5/EDD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBR5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UBR5/EDD Recombinant Protein Antigen (NBP2-58579PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for UBR5/EDD Antibody

  • DD5
  • E3 ubiquitin protein ligase, HECT domain containing, 1
  • E3 ubiquitin-protein ligase, HECT domain-containing 1
  • EC 6.3.2
  • EC 6.3.2.-
  • EDD
  • EDD1
  • EDD1E3 ubiquitin-protein ligase UBR5
  • EDDE3 identified by differential display
  • hHYD
  • HYD
  • HYDFLJ11310
  • Hyperplastic discs protein homolog
  • KIAA0896MGC57263
  • progestin induced protein
  • Progestin-induced protein
  • ubiquitin protein ligase E3 component n-recognin 5
  • ubiquitin-protein ligase
  • UBR5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00007337-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-66825
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-27201
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53246
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for UBR5/EDD Antibody (NBP2-58579) (0)

There are no publications for UBR5/EDD Antibody (NBP2-58579).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBR5/EDD Antibody (NBP2-58579) (0)

There are no reviews for UBR5/EDD Antibody (NBP2-58579). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for UBR5/EDD Antibody (NBP2-58579) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UBR5/EDD Products

Bioinformatics Tool for UBR5/EDD Antibody (NBP2-58579)

Discover related pathways, diseases and genes to UBR5/EDD Antibody (NBP2-58579). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBR5/EDD Antibody (NBP2-58579)

Discover more about diseases related to UBR5/EDD Antibody (NBP2-58579).
 

Pathways for UBR5/EDD Antibody (NBP2-58579)

View related products by pathway.

PTMs for UBR5/EDD Antibody (NBP2-58579)

Learn more about PTMs related to UBR5/EDD Antibody (NBP2-58579).
 

Research Areas for UBR5/EDD Antibody (NBP2-58579)

Find related products by research area.

Blogs on UBR5/EDD

There are no specific blogs for UBR5/EDD, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBR5/EDD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBR5