UBE2Q2 Antibody (2H3)

Images

 
Western Blot: UBE2Q2 Antibody (2H3) [H00092912-M04] - Analysis of UBE2Q2 expression in A-431 (Cat # L015V1).
Immunocytochemistry/ Immunofluorescence: UBE2Q2 Antibody (2H3) [H00092912-M04] - Analysis of monoclonal antibody to UBE2Q2 on A-431 cell. Antibody concentration 10 ug/ml
ELISA: UBE2Q2 Antibody (2H3) [H00092912-M04] - Detection limit for recombinant GST tagged UBE2Q2 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2H3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UBE2Q2 Antibody (2H3) Summary

Immunogen
UBE2Q2 (NP_775740, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLY
Specificity
UBE2Q2 (2H3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UBE2Q2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate for Western Blot. Has also been used for immunofluoresence and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UBE2Q2 Antibody (2H3)

  • DKFZp762C143
  • EC 6.3.2.19
  • LOC92912
  • UBE2Q2
  • Ubiquitin carrier protein Q2
  • ubiquitin-conjugating enzyme E2 Q2
  • ubiquitin-conjugating enzyme E2Q (putative) 2
  • ubiquitin-conjugating enzyme E2Q family member 2
  • Ubiquitin-protein ligase Q2

Background

UBE2Q2 catalyzes the covalent attachment of ubiquitin to other proteins (Probable)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for UBE2Q2 Antibody (H00092912-M04) (0)

There are no publications for UBE2Q2 Antibody (H00092912-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBE2Q2 Antibody (H00092912-M04) (0)

There are no reviews for UBE2Q2 Antibody (H00092912-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UBE2Q2 Antibody (H00092912-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBE2Q2 Products

Array H00092912-M04

Research Areas for UBE2Q2 Antibody (H00092912-M04)

Find related products by research area.

Blogs on UBE2Q2

There are no specific blogs for UBE2Q2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBE2Q2 Antibody (2H3) and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2Q2
Entrez
Uniprot