UBE2G2 Antibody

Images

 
Western Blot: UBE2G2 Antibody [H00007327-D01P] - Analysis of UBE2G2 expression in Jurkat.
Immunocytochemistry/ Immunofluorescence: UBE2G2 Antibody [H00007327-D01P] - Analysis of antibody to UBE2G2 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: UBE2G2 Antibody [H00007327-D01P] - Analysis of UBE2G2 expression in mouse kidney.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UBE2G2 Antibody Summary

Immunogen
UBE2G2 (NP_872630.1, 1 a.a. - 137 a.a.) full-length human protein. MNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBE2G2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UBE2G2 Antibody

  • EC 6.3.2.19
  • UBC7
  • UBC7human ubiquitin conjugating enzyme G210ubiquitin-conjugating enzyme E2G 2 (homologous to yeast UBC7)
  • UBE2G2
  • Ubiquitin carrier protein G2
  • ubiquitin conjugating enzyme 7
  • ubiquitin conjugating enzyme G2
  • ubiquitin-conjugating enzyme E2 G2
  • ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast)
  • Ubiquitin-protein ligase G2

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse counterpart. This gene is ubiquitously expressed, with high expression seen in adult muscle. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45402
Species: Hu
Applications: WB, Flow, IHC
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15374
Species: Hu
Applications: WB, Func, IHC, IHC-P, In vitro
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB100-2265
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, KO
MAB6609
Species: Hu, Mu
Applications: WB, IHC
NBP2-30367
Species: Hu
Applications: WB, IP
NBP2-46270
Species: Hu
Applications: WB, IHC
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB500-168
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
E2-695
Species: Hu
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB100-77316
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P, IP
H00007327-D01P
Species: Hu, Mu
Applications: WB, ICC/IF

Publications for Ube2g2/Ubc7 Antibody (H00007327-D01P) (0)

There are no publications for Ube2g2/Ubc7 Antibody (H00007327-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ube2g2/Ubc7 Antibody (H00007327-D01P) (0)

There are no reviews for Ube2g2/Ubc7 Antibody (H00007327-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ube2g2/Ubc7 Antibody (H00007327-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBE2G2 Products

Bioinformatics Tool for Ube2g2/Ubc7 Antibody (H00007327-D01P)

Discover related pathways, diseases and genes to Ube2g2/Ubc7 Antibody (H00007327-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ube2g2/Ubc7 Antibody (H00007327-D01P)

Discover more about diseases related to Ube2g2/Ubc7 Antibody (H00007327-D01P).
 

Pathways for Ube2g2/Ubc7 Antibody (H00007327-D01P)

View related products by pathway.

PTMs for Ube2g2/Ubc7 Antibody (H00007327-D01P)

Learn more about PTMs related to Ube2g2/Ubc7 Antibody (H00007327-D01P).

Blogs on UBE2G2

There are no specific blogs for UBE2G2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBE2G2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2G2
Entrez
Uniprot