UbcH5b/UBE2D2 Antibody - BSA Free

Western Blot: UbcH5b/UBE2D2 Antibody [NBP1-81769] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunocytochemistry/Immunofluorescence: UbcH5b/UBE2D2 Antibody [NBP1-81769] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: UbcH5b/UBE2D2 Antibody [NBP1-81769] - Staining of human breast shows cytoplasmic and nuclear positivity in glandular cells.

Western Blot: UbcH5b/UBE2D2 Antibody [NBP1-81769] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UbcH5b/UBE2D2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit UbcH5b/UBE2D2 Antibody - BSA Free (NBP1-81769) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-UbcH5b/UBE2D2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UBE2D2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  UbcH5b/UBE2D2 Recombinant Protein Antigen (NBP1-81769PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for UbcH5b/UBE2D2 Antibody - BSA Free

• E2(17)KB2
• EC 6.3.2.19
• PUBC1
• UBC4/5
• UBC4ubiquitin-conjugating enzyme E2D 2 (homologous to yeast UBC4/5)
• UBC5B
• UBCH4
• UbcH5b
• UBE2D2
• Ubiquitin carrier protein D2
• ubiquitin-conjugating enzyme E2 D2
• Ubiquitin-conjugating enzyme E2(17)KB 2
• Ubiquitin-conjugating enzyme E2-17 kDa 2
• ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast)
• Ubiquitin-protein ligase D2

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Two alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for UbcH5b/UBE2D2 Antibody (NBP1-81769)(1)

Publication using NBP1-81769

• Wu HH, Leng S, Abuetabh Y et al. The SWIB/MDM2 motif of UBE4B activates the p53 pathway Molecular therapy. Nucleic acids 2023-03-14 [PMID: 36865087] (WB, Human)

Bioinformatics

• Gene Symbol: UBE2D2