| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit UbcH5b/UBE2D2 Antibody - BSA Free (NBP1-81769) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-UbcH5b/UBE2D2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UBE2D2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-81769 | Applications | Species |
|---|---|---|
| Wu HH, Leng S, Abuetabh Y et al. The SWIB/MDM2 motif of UBE4B activates the p53 pathway Molecular therapy. Nucleic acids 2023-03-14 [PMID: 36865087] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for UbcH5b/UBE2D2 Antibody (NBP1-81769)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UBE2D2 |