UbcH10/UBE2C Antibody - BSA Free

Western Blot: UbcH10/UBE2C Antibody [NBP1-58166] - Human Muscle lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

UbcH10/UBE2C Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to UBE2C(ubiquitin-conjugating enzyme E2C) The peptide sequence was selected from the middle region of UBE2C. Peptide sequence QGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNP. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UBE2C
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for UbcH10/UBE2C Antibody - BSA Free

• cyclin-selective ubiquitin carrier protein
• dJ447F3.2
• EC 6.3.2.19
• UbcH10
• UBCH10mitotic-specific ubiquitin-conjugating enzyme
• UBE2C
• Ubiquitin carrier protein C
• ubiquitin carrier protein E2-C
• ubiquitin-conjugating enzyme E2 C
• ubiquitin-conjugating enzyme E2C
• Ubiquitin-protein ligase C

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2C is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UBE2C
• Uniprot:
  • O00762(Human)