UAP56 Antibody - BSA Free

Western Blot: DDX39 Antibody [NBP2-46824] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251 MG

Immunocytochemistry/Immunofluorescence: DDX39 Antibody [NBP2-46824] - Staining of human cell line MCF7 shows localization to nuclear speckles.

Immunohistochemistry-Paraffin: DDX39 Antibody [NBP2-46824] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UAP56 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATL
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DDX39B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  UAP56 Recombinant Protein Antigen (NBP2-46824PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for UAP56 Antibody - BSA Free

• 56 kDa U2AF65-associated protein
• ATP-dependent RNA helicase p47
• DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B
• DEAD box protein UAP56
• EC 3.6.4.13
• HLA-B associated transcript 1
• HLA-B-associated transcript 1 protein
• spliceosome RNA helicase BAT1
• UAP56D6S81EBAT1nuclear RNA helicase (DEAD family)

Background

UAP56 encodes a member of the DEAD box family of RNA-dependent ATPases that mediate ATP hydrolysis during pre-mRNA splicing. The encoded protein is an essential splicing factor required for association of U2 small nuclear ribonucleoprotein with pre-mRNA, and also plays an important role in mRNA export from the nucleus to the cytoplasm. A cluster of genes, BAT1-BAT5, is localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. Mutations in this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants encoding the same protein have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DDX39B
• Entrez:
  • 10212(Human)
• Uniprot:
  • O00148(Human)