U11/U12-35K Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: U11/U12-35K Antibody [NBP2-56203] - Staining of human cell line MCF7 shows localization to nucleoli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

U11/U12-35K Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERS
Specificity
Specificity of human U11/U12-35K antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNRNP35
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
U11/U12-35K Recombinant Protein Antigen (NBP2-56203PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for U11/U12-35K Antibody

  • HM1
  • HM-1
  • MGC138160
  • Protein HM-1
  • small nuclear ribonucleoprotein 35kDa (U11/U12)
  • U1 snRNP-binding protein homolog
  • U11/U12 small nuclear ribonucleoprotein 35 kDa protein
  • U11/U12 snRNP 35 kDa protein
  • U11/U12 snRNP 35K
  • U11/U12-35K
  • U1-snRNP binding protein homolog
  • U1SNRNPBPU1 snRNP binding protein homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DDX0390P-100
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, B/N, IHC-FrFl
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NBP1-87466
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NLS1331
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Gp, Ha, Pm, Pm, Rb, Sh
Applications: IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF-258-PB
Species: Hu
Applications: WB, Simple Western, IHC
NB100-56618
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-CS
NBP1-32905
Species: Hu, Bv, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24653
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
440-M3/CF
Species: Mu
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56203
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for U11/U12-35K Antibody (NBP2-56203) (0)

There are no publications for U11/U12-35K Antibody (NBP2-56203).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for U11/U12-35K Antibody (NBP2-56203) (0)

There are no reviews for U11/U12-35K Antibody (NBP2-56203). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for U11/U12-35K Antibody (NBP2-56203) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional U11/U12-35K Products

Bioinformatics Tool for U11/U12-35K Antibody (NBP2-56203)

Discover related pathways, diseases and genes to U11/U12-35K Antibody (NBP2-56203). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for U11/U12-35K Antibody (NBP2-56203)

Discover more about diseases related to U11/U12-35K Antibody (NBP2-56203).

PTMs for U11/U12-35K Antibody (NBP2-56203)

Learn more about PTMs related to U11/U12-35K Antibody (NBP2-56203).

Blogs on U11/U12-35K

There are no specific blogs for U11/U12-35K, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our U11/U12-35K Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNRNP35