TWEAK/TNFSF12 Antibody (4H3)

Western Blot: TWEAK/TNFSF12 Antibody (4H3) [H00008742-M01] - TNFSF12 monoclonal antibody (M01), clone 4H3. Analysis of TNFSF12 expression in Raw 264.7.

Sandwich ELISA: TWEAK/TNFSF12 Antibody (4H3) [H00008742-M01] - Detection limit for recombinant GST tagged TNFSF12 is approximately 0.03ng/ml as a capture antibody.

Product Discontinued

TWEAK/TNFSF12 Antibody (4H3) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: TNFSF12 (AAH19047, 49 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQADGGYTTCLRP
• Specificity: TNFSF12 - tumor necrosis factor (ligand) superfamily, member 12
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TNFSF12
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TWEAK/TNFSF12 Antibody (4H3)

• APO3 ligand
• APO3LMGC20669
• DR3LGTWEAKAPO3/DR3 ligand
• MGC129581
• TNF-related weak inducer of apoptosis
• TNFSF12
• tumor necrosis factor (ligand) superfamily, member 12
• tumor necrosis factor ligand superfamily member 12
• TWEAK

Background

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is a ligand for the FN14/TWEAKR receptor. This cytokine has overlapping signaling functions with TNF, but displays a much wider tissue distribution. This cytokine can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. This cytokine is also found to promote proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TNFSF12
• Entrez:
  • 8742(Human)
• OMIM:
  • 602695(Human)
• Uniprot:
  • AAH19047(Human)