TUT1 Antibody - BSA Free

Western Blot: TUT1 Antibody [NBP2-86028] - Host: Rabbit. Target: TUT1. Positive control (+): MCF7 Cell Lysate (N10). Negative control (-): Human Lung (LU). Antibody concentration: 1ug/ml

Western Blot: TUT1 Antibody [NBP2-86028] - Host: Rabbit. Target Name: TUT1. Sample Tissue: Human MCF7 Whole Cell. Antibody Dilution: 1ug/ml

Western Blot: TUT1 Antibody [NBP2-86028] - WB Suggested Anti-TUT1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: 293T cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TUT1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human TUT1. Peptide sequence: CDLDLFLDLGDLEEPQPVPKAPESPSLDSALASPLDPQALACTPASPPDS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TUT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TUT1 Antibody - BSA Free

• EC 2.7.7.19
• EC 2.7.7.52
• FLJ21850
• FLJ22267
• FLJ22347
• MGC131987
• MGC149809
• nuclear speckle targeted phosphatidylinositol 4-phosphate 5-kinase type I-alpharegulated-poly(A) polymerase
• nuclear speckle-targeted PIPK1A-regulated-poly(A) polymerase
• PAP-associated domain-containing 2
• PAPD2
• poly(A) polymerase associated domain containing 2
• RBM21
• RNA binding motif protein 21
• RNA uridylyltransferase
• RNA-binding motif protein 21
• RNA-binding protein 21
• speckle targeted PIP5K1A-regulated poly(A) polymerase
• STARPAP
• star-PAP
• terminal uridylyl transferase 1, U6 snRNA-specific
• TUTase
• U6 snRNA-specific terminal uridylyltransferase 1
• U6 TUTase
• U6-TUTase

Background

The TUT1 gene encodes a nucleotidyl transferase that functions as both a terminal uridylyltransferase and a nuclear poly(A)polymerase. The encoded enzyme specifically adds and removes nucleotides from the 3' end of small nuclear RNAsand select mRNAs and may f

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TUT1