TUSC5 Antibody - BSA Free

Immunohistochemistry: TUSC5 Antibody [NBP2-48982] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TUSC5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QSEFPSAQEPGSAAFLDLPEMEILLTKAENKDDKTLNLSKTLSGPLDLEQNSQGLPFKAISEGHLEAPLPRSPSRASSRRASSIATTSYAQDQE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TUSC5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TUSC5 Recombinant Protein Antigen (NBP2-48982PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TUSC5 Antibody - BSA Free

• IFITMD3located at seventeen p thirteen point three 1
• Interferon-induced transmembrane domain-containing protein D3
• LOST1interferon induced transmembrane protein domain containing 3
• Protein located at seventeen-p-thirteen point three 1
• tumor suppressor candidate 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TUSC5