Tubulin Beta 2C Antibody (1G3) - Azide and BSA Free Summary
                         
                                
                                
                                
            | Description | Novus Biologicals Mouse Tubulin Beta 2C Antibody (1G3) - Azide and BSA Free (H00010383-M02) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. | 
            | Immunogen | TUBB4B (AAH01911, 1 a.a. ~ 445 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFEEEAEEEVA | 
            | Specificity | TUBB2C - tubulin, beta, 2 | 
            | Isotype | IgG1 Kappa | 
            | Clonality | Monoclonal | 
            | Host | Mouse | 
            | Gene | TUBB4B | 
            | Purity | IgG purified | 
            | Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. | 
                                
                          Applications/Dilutions
                                
                                    
                                    
                                        
                              
                                  | Dilutions | ELISA Immunocytochemistry/ Immunofluorescence Western Blot 1:500
 | 
            | Application Notes | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. | 
                                    
                                 Reactivity Notes
                        
                                
                                        
                                        Human. Other species not tested.
                                          Packaging, Storage & Formulations
            | Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. | 
            | Buffer | In 1x PBS, pH 7.4 | 
            | Preservative | No Preservative | 
            | Purity | IgG purified | 
Notes
                    
                        This product is produced by and distributed for Abnova, a company based in Taiwan.
                     Alternate Names for Tubulin Beta 2C Antibody (1G3) - Azide and BSA Free
                     Background
 
                    
                    Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain
                      Limitations
 
                    
                    This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are 
guaranteed for 1 year from date of receipt.
 Customers Who Viewed This Item Also Viewed...
                
                
                            
                                  
                                       
                                                
                                                Species: Bv, Ce, Ch, ChHa, Hu, I, In, Mu, Po, Pm, Rt, Xp, Ze
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
                                     
                                 
                             
                            
                                  
                                       
                                                Species: Hu
Applications: ICC, WB
                                     
                                 
                              
                            
                                  
                                       
                                                
                                                Species: All-Multi
Applications: ICC, IHC, ICFlow, Simple Western, WB
                                     
                                 
                             
                            
                                  
                                       
                                                Species: Hu
Applications: ICC, IHC, WB
                                     
                                 
                              
                            
                                  
                                       Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
                                     
                             
                            
                                  
                                       
                                                Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB
                                     
                                 
                              
                            
                                  
                                       
                                                Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
                                     
                                 
                             
                            
                                  
                                       
                                                
                                                Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gt, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
                                     
                                 
                              
                            
                                  
                                       
                                                
                                                Species: Bv, Ch, Ha, Hu, Mu, Rt
Applications: ICC, ICC/IF, IHC,  IHC-P, IP, WB
                                     
                                 
                             
                            
                                  
                                       Species: Ca, Hu, Mu, Pm
Applications: ICC/IF, IHC,  IHC-P, WB
                                     
                              
                            
                                  
                                       
                                                Species: Hu
Applications: Simple Western, WB
                                     
                                 
                             
                            
                                  
                                       
                                                
                                                Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, Simple Western, WB
                                     
                                 
                              
                            
                                  
                                       
                                                
                                                Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gt, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
                                     
                                 
                             
                            
                                  
                                       
                                                Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
                                     
                                 
                              
                            
                                  
                                       
                                                Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
                                     
                                 
                             
                            
                                  
                                       
                                                
                                                Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr,  IHC-P, WB
                                     
                                 
                              
                            
                                  
                                       Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
                                     
                             
                            
                                  
                                       
                                                
                                                Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
                                     
                                 
                              
                            
                                  
                                       
                                                
                                                Species: Hu, Mu
Applications: IHC,  IHC-P, IP, KD, WB
                                     
                                 
                             
                            
                                  
                                       Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
                                     
                              
                   
                  
            
                        
                        Publications for Tubulin Beta 2C Antibody (H00010383-M02) (0)
             
            
                        There are no publications for Tubulin Beta 2C Antibody (H00010383-M02).
                        By submitting your publication information earn gift cards and discounts for future purchases.
             
            
                        
                        Reviews for Tubulin Beta 2C Antibody (H00010383-M02) (0)	
                        
                        There are no reviews for Tubulin Beta 2C Antibody (H00010383-M02).
                        By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount. 
                            
                                - Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
   
                  Product General Protocols
                        
                        Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
                        
Video Protocols
                        
                          FAQs for Tubulin Beta 2C Antibody (H00010383-M02) (0)
                        
                             
                  | Secondary Antibodies |  | Isotype Controls | 
Additional Tubulin Beta 2C Products
                            
                            | Research Areas for Tubulin Beta 2C Antibody (H00010383-M02)Find related products by research area. | 
Blogs on Tubulin Beta 2C