Tubulin Beta 2C Antibody (1F9) - Azide and BSA Free Summary
| Immunogen |
TUBB4B (AAH01911, 1 a.a. ~ 445 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFEEEAEEEVA |
| Specificity |
TUBB2C - tubulin, beta, 2 |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
TUBB4B |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Tubulin Beta 2C Antibody (1F9) - Azide and BSA Free
Background
Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ce, Ch, ChHa, Hu, I, In, Mu, Po, Pm, Rt, Xp, Ze
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC, WB
Species: All-Multi
Applications: ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gt, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Species: Bv, Ch, Ha, Hu, Mu, Rt
Applications: ICC, ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gt, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Publications for Tubulin Beta 2C Antibody (H00010383-M01) (0)
There are no publications for Tubulin Beta 2C Antibody (H00010383-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Tubulin Beta 2C Antibody (H00010383-M01) (0)
There are no reviews for Tubulin Beta 2C Antibody (H00010383-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Tubulin Beta 2C Antibody (H00010383-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Tubulin Beta 2C Products
Research Areas for Tubulin Beta 2C Antibody (H00010383-M01)
Find related products by research area.
|
Blogs on Tubulin Beta 2C