TTLL10 Antibody

Images

 
Western Blot: TTLL10 Antibody [NBP1-93819] - Analysis in control (vector only transfected HEK293T lysate) and TTLL10 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: TTLL10 Antibody [NBP1-93819] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TTLL10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KPTASNQGKGIFLLRNQEEVAALQAKTRSMEDDPIHHKTPFRGPQARVVQRYIQNPLLVDGRKFDVRSYLLIACTTPYMIFFGHGYARLTLSLYDPHSSDLG
Specificity
Specificity of human TTLL10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TTLL10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TTLL10 Protein (NBP1-93819PEP)
Publications
Read Publication using NBP1-93819.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TTLL10 Antibody

  • FLJ42131
  • member 5
  • tubulin tyrosine ligase-like family, member 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1756
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, Gp, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
H00051531-B01P
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-24727
Species: Hu, Mu, Ca
Applications: WB, ICC/IF
NBP1-32339
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-WhMt
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88924
Species: Hu
Applications: IHC, IHC-P
NB110-68133
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88391
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB200-310
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, IP
NB120-5802
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP
MAB3481
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF4838
Species: Hu
Applications: WB, Simple Western
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-36543
Species: Hu
Applications: WB, IP
MAB5277
Species: Hu
Applications: WB, IHC

Publications for TTLL10 Antibody (NBP1-93819)(1)

Reviews for TTLL10 Antibody (NBP1-93819) (0)

There are no reviews for TTLL10 Antibody (NBP1-93819). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TTLL10 Antibody (NBP1-93819) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TTLL10 Products

Bioinformatics Tool for TTLL10 Antibody (NBP1-93819)

Discover related pathways, diseases and genes to TTLL10 Antibody (NBP1-93819). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TTLL10 Antibody (NBP1-93819)

View related products by pathway.

PTMs for TTLL10 Antibody (NBP1-93819)

Learn more about PTMs related to TTLL10 Antibody (NBP1-93819).

Blogs on TTLL10

There are no specific blogs for TTLL10, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTLL10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TTLL10