TTL Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TTL Antibody [NBP2-57533] - Staining of human cell line BJ shows localization to nucleoplasm & vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TTL Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LQIKHIIRNCLLSVEPAISTKHLPYQSFQLFGFDFMVDEELKVWLIEVNGAPACAQKLYAELCQGIVDIAISSVFPPPDVEQPQTQP
Specificity
Specificity of human TTL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TTL
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TTL Recombinant Protein Antigen (NBP2-57533PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TTL Antibody

  • EC 6.3.2.25,2410003M22Rik
  • MGC46235
  • tubulin tyrosine ligase
  • tubulin-tyrosine ligase
  • tubulin--tyrosine ligase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43837
Species: Hu, Mu, Rt, Dr, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-52575
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-85569
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19613
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-1800
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P, IP
NBP1-85568
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP2-49041
Species: Hu
Applications: IHC, IHC-P
NBP1-32805
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-125
Species: Hu
Applications: WB, ICC/IF
NBP1-47704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-119
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-67232
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TTL Antibody (NBP2-57533) (0)

There are no publications for TTL Antibody (NBP2-57533).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTL Antibody (NBP2-57533) (0)

There are no reviews for TTL Antibody (NBP2-57533). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TTL Antibody (NBP2-57533) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TTL Antibody (NBP2-57533)

Discover related pathways, diseases and genes to TTL Antibody (NBP2-57533). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTL Antibody (NBP2-57533)

Discover more about diseases related to TTL Antibody (NBP2-57533).
 

Pathways for TTL Antibody (NBP2-57533)

View related products by pathway.

PTMs for TTL Antibody (NBP2-57533)

Learn more about PTMs related to TTL Antibody (NBP2-57533).

Blogs on TTL

There are no specific blogs for TTL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TTL