![Western Blot: C8orf41/TTI2 Antibody [NBP1-82085] - Analysis in control (vector only transfected HEK293T lysate) and TTI2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/C8orf41-TTI2-Antibody-Western-Blot-NBP1-82085-img0007.jpg "Western Blot: C8orf41/TTI2 Antibody [NBP1-82085] - Analysis in control (vector only transfected HEK293T lysate) and TTI2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QEDSNLSEELSHSAFGQAFSKILHCLARPEARRGNVKDAVLKDLGDLIEATGFDRLFEGTGARLRGMPETLGQVAKALEKY |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TTI2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Western-Blot-H00001635-M01-img0008.jpg)
-Immunohistochemistry-Paraffin-H00001635-M01-img0005.jpg)
-Western-Blot-H00001635-M01-img0006.jpg)
-Immunocytochemistry-Immunofluorescence-NBP2-88937-img0001.jpg)
-Immunohistochemistry-Paraffin-NBP2-88937-img0002.jpg)
-Immunohistochemistry-Paraffin-NBP2-88937-img0003.jpg)
-Flow-Cytometry-NBP2-00918-img0001.jpg)
-Flow-Cytometry-NBP2-00918-img0002.jpg)
-Western-Blot-NBP2-00918-img0003.jpg)
-Antibody-Western-Blot-NBP3-09392-img0001.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for TTI2 Antibody (NBP1-82085)Discover more about diseases related to TTI2 Antibody (NBP1-82085).
| Pathways for TTI2 Antibody (NBP1-82085)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TTI2 |
![Immunocytochemistry/Immunofluorescence: C8orf41/TTI2 Antibody [NBP1-82085] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli, cytoplasm and centrosome.](http://images.novusbio.com/fullsize2/C8orf41-TTI2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82085-img0004.jpg "Immunocytochemistry/Immunofluorescence: C8orf41/TTI2 Antibody [NBP1-82085] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli, cytoplasm and centrosome.")
![Immunohistochemistry-Paraffin: C8orf41/TTI2 Antibody [NBP1-82085] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.](http://images.novusbio.com/fullsize2/C8orf41-TTI2-Antibody-Immunohistochemistry-Paraffin-NBP1-82085-img0001.jpg "Immunohistochemistry-Paraffin: C8orf41/TTI2 Antibody [NBP1-82085] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.")
)-Immunohistochemistry-Paraffin-NB100-56585-img0015.jpg)
)-Immunohistochemistry-Paraffin-NB100-56585-img0016.jpg)
)-Western-Blot-NB100-56585-img0017.jpg)
-Immunocytochemistry-Immunofluorescence-NB100-308-img0001.jpg)
-Western-Blot-NB100-308-img0004.jpg)
-Western-Blot-NB100-308-img0005.jpg)
-Immunohistochemistry-NBP2-46404-img0001.jpg)
-Immunohistochemistry-NBP2-46404-img0002.jpg)
-Immunohistochemistry-NBP2-46404-img0003.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")