TTF2 Antibody (2B6)

Images

 
Western Blot: TTF2 Antibody (2B6) [H00008458-M12] - Analysis of TTF2 expression in MES-SA/Dx5 (Cat # L021V1).
ELISA: TTF2 Antibody (2B6) [H00008458-M12] - Detection limit for recombinant GST tagged TTF2 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2B6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TTF2 Antibody (2B6) Summary

Immunogen
TTF2 (NP_003585 385 a.a. - 509 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QFPDRSVQRKVSPASGVSKKVEPSDPVARRVYLTTQLKQKKSTLASVNIQALPDKGQKLIKQIQELEEVLSGLTLSPEQGTNEKSNSQVPQQSHFTKTTTGPPHLVPPQPLPRRGTQPVGSLELK
Specificity
TTF2 (2B6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TTF2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TTF2 Antibody (2B6)

  • EC 3.6.1
  • EC 3.6.4.-
  • F2
  • HuF2lodestar protein
  • human factor 2
  • Lodestar homolog
  • RNA polymerase II termination factor
  • Transcription release factor 2
  • transcription termination factor 2
  • transcription termination factor, RNA polymerase II

Background

This gene encodes a member of the SWI2/SNF2 family of proteins, which play a critical role in altering protein-DNA interactions. The encoded protein has been shown to have dsDNA-dependent ATPase activity and RNA polymerase II termination activity. This protein interacts with cell division cycle 5-like, associates with human splicing complexes, and plays a role in pre-mRNA splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
AF904
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, Neut
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF1396
Species: Hu
Applications: WB

Publications for TTF2 Antibody (H00008458-M12) (0)

There are no publications for TTF2 Antibody (H00008458-M12).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTF2 Antibody (H00008458-M12) (0)

There are no reviews for TTF2 Antibody (H00008458-M12). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TTF2 Antibody (H00008458-M12) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TTF2 Products

Bioinformatics Tool for TTF2 Antibody (H00008458-M12)

Discover related pathways, diseases and genes to TTF2 Antibody (H00008458-M12). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTF2 Antibody (H00008458-M12)

Discover more about diseases related to TTF2 Antibody (H00008458-M12).
 

Pathways for TTF2 Antibody (H00008458-M12)

View related products by pathway.

PTMs for TTF2 Antibody (H00008458-M12)

Learn more about PTMs related to TTF2 Antibody (H00008458-M12).

Blogs on TTF2

There are no specific blogs for TTF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTF2 Antibody (2B6) and receive a gift card or discount.

Bioinformatics

Gene Symbol TTF2
Entrez
OMIM
Uniprot