TTDN1 Antibody

Images

 
Western Blot: TTDN1 Antibody [NBP2-86025] - Host: Rabbit. Target Name: MPLKIP. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TTDN1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human TTDN1. Peptide sequence: PGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRM The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
MPLKIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TTDN1 Antibody

  • ABHS
  • chromosome 7 open reading frame 11
  • ORF20
  • Russell-Silver syndrome region
  • TTD non-photosensitive 1 protein
  • TTDN1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-11392
Species: Hu
Applications: WB
NB100-61060
Species: Hu, Mu, V-Vi
Applications: ChIP, IP, WB
H00002968-B01P
Species: Hu
Applications: ICC/IF, WB
NBP3-07348
Species: Hu
Applications: Flow, ICC/IF, PA
NBP2-87539
Species: Hu
Applications: IHC, IHC-P, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB4620
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP2-33466
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF3296
Species: Hu, Mu, Rt
Applications: WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP2-30783
Species: Hu
Applications: ICC/IF, WB
NBP2-73857
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
AF6457
Species: Hu
Applications: WB
NBP2-86025
Species: Hu
Applications: WB

Publications for TTDN1 Antibody (NBP2-86025) (0)

There are no publications for TTDN1 Antibody (NBP2-86025).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTDN1 Antibody (NBP2-86025) (0)

There are no reviews for TTDN1 Antibody (NBP2-86025). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TTDN1 Antibody (NBP2-86025) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TTDN1 Products

Bioinformatics Tool for TTDN1 Antibody (NBP2-86025)

Discover related pathways, diseases and genes to TTDN1 Antibody (NBP2-86025). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TTDN1 Antibody (NBP2-86025)

View related products by pathway.

PTMs for TTDN1 Antibody (NBP2-86025)

Learn more about PTMs related to TTDN1 Antibody (NBP2-86025).

Blogs on TTDN1

There are no specific blogs for TTDN1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTDN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MPLKIP