TTC12 Antibody


Immunohistochemistry-Paraffin: TTC12 Antibody [NBP2-57113] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

TTC12 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NSDDPVVQQKAVLETEKRLLLMEEDQEEDECRTTLNKTMISPPQTAMKSAEEINSEAFLASVEKDAKERAKRRRENKV
Specificity of human TTC12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for TTC12 Antibody

  • FLJ13859
  • FLJ20535
  • tetratricopeptide repeat domain 12
  • tetratricopeptide repeat protein 12 variant 1
  • tetratricopeptide repeat protein 12 variant 2
  • TPARMtetratricopeptide repeat protein 12
  • TPR repeat protein 12


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE, Flow-CS
Species: Hu, Bt, Bv, Ca, Eq, Rb
Applications: IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Rb
Applications: WB
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P

Publications for TTC12 Antibody (NBP2-57113) (0)

There are no publications for TTC12 Antibody (NBP2-57113).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTC12 Antibody (NBP2-57113) (0)

There are no reviews for TTC12 Antibody (NBP2-57113). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TTC12 Antibody (NBP2-57113) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional TTC12 Products

Bioinformatics Tool for TTC12 Antibody (NBP2-57113)

Discover related pathways, diseases and genes to TTC12 Antibody (NBP2-57113). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTC12 Antibody (NBP2-57113)

Discover more about diseases related to TTC12 Antibody (NBP2-57113).

Pathways for TTC12 Antibody (NBP2-57113)

View related products by pathway.

PTMs for TTC12 Antibody (NBP2-57113)

Learn more about PTMs related to TTC12 Antibody (NBP2-57113).

Blogs on TTC12

There are no specific blogs for TTC12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TTC12 Antibody and receive a gift card or discount.


Gene Symbol TTC12