FOXN4 Antibody - BSA Free Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human FOXN4 (NP_998761). Peptide sequence HHQVQPQAHLAPDSPAPAQTPPLHALPDLSPSPLPHPAMGRAPVDFINIS |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
FOXN4 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
56 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for FOXN4 Antibody - BSA Free
Background
Members of the winged-helix/forkhead family of transcription factors, such as FOXN4, are characterized by a 110-aminoacid DNA-binding domain that can fold into a variant of the helix-turn-helix motif consisting of 3 alpha helicesflanked by 2 large loops or wings. These transcription factors are involved in a variety of biologic processes as keyregulators in development and metabolism (Li et al., 2004 (PubMed 15363391)).(supplied by OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Hu, Mu
Applications: PEP-ELISA, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Publications for FOXN4 Antibody (NBP3-09250) (0)
There are no publications for FOXN4 Antibody (NBP3-09250).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FOXN4 Antibody (NBP3-09250) (0)
There are no reviews for FOXN4 Antibody (NBP3-09250).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FOXN4 Antibody (NBP3-09250) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FOXN4 Products
Blogs on FOXN4