TSSC3 Antibody (5E3)

Images

 
Sandwich ELISA: TSSC3 Antibody (5E3) [H00007262-M01] - Detection limit for recombinant GST tagged PHLDA2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, S-ELISA
Clone
5E3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TSSC3 Antibody (5E3) Summary

Immunogen
PHLDA2 (NP_003302, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDF
Specificity
PHLDA2 - pleckstrin homology-like domain, family A, member 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PHLDA2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00007262-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TSSC3 Antibody (5E3)

  • Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein
  • BWR1Cp17-Beckwith-Wiedemann region 1 C
  • HLDA2BRW1C
  • Imprinted in placenta and liver protein
  • IPLp17-BWR1C
  • pleckstrin homology-like domain family A member 2
  • pleckstrin homology-like domain, family A, member 2
  • TSSC3p17-Beckwith-Wiedemann region 1C
  • tumor suppressing subchromosomal transferable fragment cDNA 3
  • tumor suppressing subtransferable candidate 3
  • Tumor-suppressing STF cDNA 3 protein
  • Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein
  • tumor-supressing STF cDNA 3

Background

This gene is one of several genes in the imprinted gene domain of 11p15.5 which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Studies of the mouse gene, however, which is also located in an imprinted gene domain, have shown that the product of this gene regulates placental growth.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89785
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP1-30052
Species: Hu, Mu, Rt, Ch, Gp, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl, IHC-WhMt
NBP2-56316
Species: Hu
Applications: IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86615
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-12897
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP2-13306
Species: Hu
Applications: WB, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NB300-132
Species: Hu, Mu, Rt, Av, Bv, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00007262-M01
Species: Hu
Applications: WB, ELISA, IHC, S-ELISA

Publications for TSSC3 Antibody (H00007262-M01)(1)

Reviews for TSSC3 Antibody (H00007262-M01) (0)

There are no reviews for TSSC3 Antibody (H00007262-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSSC3 Antibody (H00007262-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TSSC3 Products

Bioinformatics Tool for TSSC3 Antibody (H00007262-M01)

Discover related pathways, diseases and genes to TSSC3 Antibody (H00007262-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSSC3 Antibody (H00007262-M01)

Discover more about diseases related to TSSC3 Antibody (H00007262-M01).
 

Pathways for TSSC3 Antibody (H00007262-M01)

View related products by pathway.

PTMs for TSSC3 Antibody (H00007262-M01)

Learn more about PTMs related to TSSC3 Antibody (H00007262-M01).
 

Research Areas for TSSC3 Antibody (H00007262-M01)

Find related products by research area.

Blogs on TSSC3

There are no specific blogs for TSSC3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSSC3 Antibody (5E3) and receive a gift card or discount.

Bioinformatics

Gene Symbol PHLDA2
Entrez
OMIM
Uniprot