TSPYL1 Antibody - BSA Free

Western Blot: TSPYL1 Antibody [NBP2-38191] - Analysis using Anti-TSPYL1 antibody NBP2-38191 (A) shows similar pattern to independent antibody NBP1-86898 (B).

Immunocytochemistry/Immunofluorescence: TSPYL1 Antibody [NBP2-38191] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.

Immunohistochemistry: TSPYL1 Antibody [NBP2-38191] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TSPYL1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LDGVKRTTPLQTHSIIISDQVPSDQDAHQYLRLRDQSEATQVMAEPGEGGSETVALPPSPPSEEGGVPQDPAGRGGTPQIRVVG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TSPYL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TSPYL1 Protein (NBP2-38191PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TSPYL1 Antibody - BSA Free

• SIDDT
• testis-specific Y-encoded-like protein 1
• TSPY-like 1
• TSPY-like protein 1
• TSPY-like
• TSPYLtestis-specific-like protein, Y encoded

Background

The protein encoded by the TSPYL1 gene is found in the nucleolus and is similar to that of a family of genes on the Y-chromosome. This gene is intronless. Defects in this gene are a cause of sudden infant death with dysgenesis of the testes syndrome (SIDDT). (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TSPYL1
• Uniprot:
  • Q9H0U9(Human)