TSPAN2 Antibody (1F2) Summary
Immunogen |
TSPAN2 (NP_005716, 112 a.a. ~ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQ |
Specificity |
TSPAN2 - tetraspanin 2 (1F2) |
Isotype |
IgG2b Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
TSPAN2 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500
- ELISA
- Sandwich ELISA
|
Application Notes |
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for TSPAN2 Antibody (1F2)
Background
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, In vivo
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Gt, Pm, Sh
Applications: WB, DB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, In vitro, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Rb
Applications: WB, Flow, IHC, IP, CyTOF-ready
Publications for TSPAN2 Antibody (H00010100-M05) (0)
There are no publications for TSPAN2 Antibody (H00010100-M05).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TSPAN2 Antibody (H00010100-M05) (0)
There are no reviews for TSPAN2 Antibody (H00010100-M05).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TSPAN2 Antibody (H00010100-M05) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional TSPAN2 Products
Bioinformatics Tool for TSPAN2 Antibody (H00010100-M05)
Discover related pathways, diseases and genes to TSPAN2 Antibody (H00010100-M05). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for TSPAN2 Antibody (H00010100-M05)
Discover more about diseases related to TSPAN2 Antibody (H00010100-M05).
| | Pathways for TSPAN2 Antibody (H00010100-M05)
View related products by pathway.
|
PTMs for TSPAN2 Antibody (H00010100-M05)
Learn more about PTMs related to TSPAN2 Antibody (H00010100-M05).
|
Blogs on TSPAN2