TSPAN2 Antibody (1F2) - Azide and BSA Free

ELISA: TSPAN2 Antibody (1F2) [H00010100-M05] - Detection limit for recombinant GST tagged TSPAN2 is approximately 1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1F2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TSPAN2 Antibody (1F2) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse TSPAN2 Antibody (1F2) - Azide and BSA Free (H00010100-M05) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: TSPAN2 (NP_005716, 112 a.a. ~ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQ
• Specificity: TSPAN2 - tetraspanin 2 (1F2)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TSPAN2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TSPAN2 Antibody (1F2) - Azide and BSA Free

• FLJ12082
• NET3
• new EST tetraspan 3
• tetraspan 2
• Tetraspan NET-3
• tetraspan TM4SF
• tetraspanin 2 isoform
• tetraspanin 2
• tetraspanin-2
• TSN2
• TSPAN2
• TSPAN-2

Background

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TSPAN2
• Entrez:
  • 10100(Human)
• Uniprot:
  • NP_005716()