TSPAN2 Antibody (1F2)


ELISA: TSPAN2 Antibody (1F2) [H00010100-M05] - Detection limit for recombinant GST tagged TSPAN2 is approximately 1ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA

Order Details

TSPAN2 Antibody (1F2) Summary

TSPAN2 (NP_005716, 112 a.a. ~ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQ
TSPAN2 - tetraspanin 2 (1F2)
IgG2b Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:500
  • Sandwich ELISA
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative
IgG purified


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TSPAN2 Antibody (1F2)

  • FLJ12082
  • NET3
  • new EST tetraspan 3
  • tetraspan 2
  • Tetraspan NET-3
  • tetraspan TM4SF
  • tetraspanin 2 isoform
  • tetraspanin 2
  • tetraspanin-2
  • TSN2
  • TSPAN2
  • TSPAN-2


The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, In vivo
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Gt, Pm, Sh
Applications: WB, DB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, In vitro, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Rb
Applications: WB, Flow, IHC, IP, CyTOF-ready

Publications for TSPAN2 Antibody (H00010100-M05) (0)

There are no publications for TSPAN2 Antibody (H00010100-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSPAN2 Antibody (H00010100-M05) (0)

There are no reviews for TSPAN2 Antibody (H00010100-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSPAN2 Antibody (H00010100-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional TSPAN2 Products

Array H00010100-M05

Bioinformatics Tool for TSPAN2 Antibody (H00010100-M05)

Discover related pathways, diseases and genes to TSPAN2 Antibody (H00010100-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSPAN2 Antibody (H00010100-M05)

Discover more about diseases related to TSPAN2 Antibody (H00010100-M05).

Pathways for TSPAN2 Antibody (H00010100-M05)

View related products by pathway.

PTMs for TSPAN2 Antibody (H00010100-M05)

Learn more about PTMs related to TSPAN2 Antibody (H00010100-M05).

Blogs on TSPAN2

There are no specific blogs for TSPAN2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TSPAN2 Antibody (1F2) and receive a gift card or discount.


Gene Symbol TSPAN2