TSC2 Antibody

Images

 
Western Blot: TSC2 Antibody [NBP1-82849] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate
Immunocytochemistry/ Immunofluorescence: TSC2 Antibody [NBP1-82849] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: TSC2 Antibody [NBP1-82849] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TSC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SVLPSFYQAMACPNEVVSYEIVLSITRLIKKYRKELQVVAWDILLNIIERLLQQLQTLDSPELRTIVHDLLTTVEELCDQNEFHGSQE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TSC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TSC2 Protein (NBP1-82849PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TSC2 Antibody

  • LAM
  • LAMFLJ43106
  • TSC2
  • TSC4
  • Tuberin
  • Tuberous sclerosis 2 protein
  • tuberous sclerosis 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46234
Species: Hu
Applications: WB, IHC
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-86376
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13426
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB3426
Species: Hu, Mu, Rt
Applications: WB, IHC
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-46403
Species: Hu
Applications: IHC
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6270
Species: Hu
Applications: ICC
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow

Publications for TSC2 Antibody (NBP1-82849) (0)

There are no publications for TSC2 Antibody (NBP1-82849).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSC2 Antibody (NBP1-82849) (0)

There are no reviews for TSC2 Antibody (NBP1-82849). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TSC2 Antibody (NBP1-82849) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TSC2 Products

Bioinformatics Tool for TSC2 Antibody (NBP1-82849)

Discover related pathways, diseases and genes to TSC2 Antibody (NBP1-82849). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSC2 Antibody (NBP1-82849)

Discover more about diseases related to TSC2 Antibody (NBP1-82849).
 

Pathways for TSC2 Antibody (NBP1-82849)

View related products by pathway.

PTMs for TSC2 Antibody (NBP1-82849)

Learn more about PTMs related to TSC2 Antibody (NBP1-82849).

Blogs on TSC2.

TSC2 - GTPase activating protein involved in cell cycle inhibition
TSC2 is a tumor suppressor gene that encodes a 200 kDa protein called tuberin. TSC2 heterodimerizes with TSC1 to form a complex with GTPase-activating protein (GAP) activity. The C-terminus of TSC2 contains the GAP domain responsible for this cata...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSC2
Entrez