Recombinant Human Tryptophan rich protein GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Tryptophan rich protein GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 29-101 of Human Tryptophan rich protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PSFSSFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
GET1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
33.77 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Tryptophan rich protein GST (N-Term) Protein

  • congenital heart disease 5 protein10tryptophan-rich protein
  • FLJ51808
  • tryptophan rich basic protein

Background

This gene encodes a basic nuclear protein of unknown function. The gene is widely expressed in adult and fetal tissues. Since the region proposed to contain the gene(s) for congenital heart disease (CHD) in Down syndrome (DS) patients has been restricted to 21q22.2-22.3, this gene, which maps to 21q22.3, has a potential role in the pathogenesis of Down syndrom congenital heart disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1228
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP
MAB1228
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP
NBP2-48480
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
H00000439-M03
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP2-61879
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
NBP2-49409
Species: Hu
Applications: IHC, IHC-P
NBP3-16632
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF5738
Species: Hu
Applications: ICC, KO, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-55310
Species: Hu, Mu
Applications: IP, WB
NBP1-84492
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-69668
Species: Hu
Applications: WB
NBP2-84247
Species: Hu
Applications: WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-60414
Species: Hu
Applications: IP, WB
NB200-109
Species: Hu, Mu
Applications: ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
NB100-417
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr, PLA, Simple Western, WB
NBP1-93620
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
H00007485-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Tryptophan rich protein Partial Recombinant Protein (H00007485-Q01) (0)

There are no publications for Tryptophan rich protein Partial Recombinant Protein (H00007485-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tryptophan rich protein Partial Recombinant Protein (H00007485-Q01) (0)

There are no reviews for Tryptophan rich protein Partial Recombinant Protein (H00007485-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Tryptophan rich protein Partial Recombinant Protein (H00007485-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tryptophan rich protein Products

Bioinformatics Tool for Tryptophan rich protein Partial Recombinant Protein (H00007485-Q01)

Discover related pathways, diseases and genes to Tryptophan rich protein Partial Recombinant Protein (H00007485-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tryptophan rich protein Partial Recombinant Protein (H00007485-Q01)

Discover more about diseases related to Tryptophan rich protein Partial Recombinant Protein (H00007485-Q01).
 

Pathways for Tryptophan rich protein Partial Recombinant Protein (H00007485-Q01)

View related products by pathway.

PTMs for Tryptophan rich protein Partial Recombinant Protein (H00007485-Q01)

Learn more about PTMs related to Tryptophan rich protein Partial Recombinant Protein (H00007485-Q01).
 

Research Areas for Tryptophan rich protein Partial Recombinant Protein (H00007485-Q01)

Find related products by research area.

Blogs on Tryptophan rich protein

There are no specific blogs for Tryptophan rich protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Tryptophan rich protein GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GET1