Trypsin 2/PRSS2 Antibody (3D9O7)

Western Blot: Trypsin 2/PRSS2 Antibody (3D9O7) [NBP3-15733] - Western blot analysis of extracts of various cell lines, using Trypsin 2/PRSS2 antibody (NBP3-15733) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunohistochemistry-Paraffin: Trypsin 2/PRSS2 Antibody (3D9O7) [NBP3-15733] - Immunohistochemistry of paraffin-embedded human liver cancer using Trypsin 2/PRSS2 Rabbit mAb (NBP3-15733) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Trypsin 2/PRSS2 Antibody (3D9O7) [NBP3-15733] - Immunohistochemistry of paraffin-embedded rat pancreas using Trypsin 2/PRSS2 Rabbit mAb (NBP3-15733) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 3D9O7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Trypsin 2/PRSS2 Antibody (3D9O7) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Trypsin 2/PRSS2 (P07478). MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYN
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PRSS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:2000 - 1:6000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Trypsin 2/PRSS2 Antibody (3D9O7)

• Anionic trypsinogen
• EC 3.4.21
• EC 3.4.21.4
• MGC111183
• MGC120174
• MGC120175
• protease serine 2 preproprotein
• protease, serine, 2 (trypsin 2)
• protease, serine, 2, preproprotein
• PRSS2
• Serine protease 2
• Tesp4
• TRY2TRY8
• TRY8
• TRYP2
• Trypsin 2
• Trypsin II
• trypsin-2
• trypsinogen 2
• Trypsinogen 20

Background

PRSS2 encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRSS2