TRPV6 Antibody

Images

 
Immunohistochemistry: TRPV6 Antibody [NBP2-32372] - Time-course analysis of immunohistochemical staining of formalin-fixed intestinal sections for anti-TRPV6 from rats fed control, HP-LCa2+ , and HP-HCa2+ diets for 12 ...read more
Immunohistochemistry-Paraffin: TRPV6 Antibody [NBP2-32372] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: TRPV6 Antibody [NBP2-32372] - Staining of human testis shows strong cytoplasmic and membranous positivity in Sertoli cells.
Immunohistochemistry-Paraffin: TRPV6 Antibody [NBP2-32372] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: TRPV6 Antibody [NBP2-32372] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Product Discontinued
View other related TRPV6 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-32372
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TRPV6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SPHLSLPMPSVSRSTSRSSANWERLRQGTLRRDLRGIINRGLEDGESWEYQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRPV6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Publications
Read Publication using
NBP2-32372 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%). Use in Rat reported in scientific literature (PMID:32271147).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRPV6 Antibody

  • ABP/ZF
  • calcium channel CaT1
  • Calcium transport protein 1
  • CaT1
  • CATL
  • CaT-L
  • CaT-like
  • ECAC2
  • ECAC2caT-L
  • epithelial apical membrane calcium transporter/channel CaT1
  • Epithelial calcium channel 2Alu-binding protein with zinc finger domain
  • HSA277909
  • LP6728
  • transient receptor potential cation channel subfamily V member 6
  • transient receptor potential cation channel, subfamily V, member 6
  • TRPV6
  • ZFAB

Background

Calcium-permeable channels, such as TRPV6, participate in neurotransmission, muscle contraction, and exocytosis by providing calcium as an intracellular second messenger. Depending on the tissue, transcellular calcium transport may be regulated by vitamin D, parathyroid hormone (PTH), or calcitonin (CALCA); FUNCTION: Calcium selective cation channel probably involved in Ca(2+) uptake in various tissues, including Ca(2+) reabsorption in intestine. The channel is activated by low internal calcium level, probably including intracellular calcium store depletion, and the current exhibits an inward rectification. Inactivation includes both, a rapid Ca(2+)-dependent and a slower Ca(2+)-calmodulin-dependent mechanism, the latter may be regulated by phosphorylation. In vitro, is slowly inhibited by Mg(2+) in a voltage-independent manner. Heteromeric assembly with TRPV5 seems to modify channel properties. TRPV5-TRPV6 heteromultimeric concatemers exhibit voltage-dependent gating. SUBUNIT: Homotetramer and probably heterotetramer with TRPV5. Interacts with TRPV5. Interacts with S100A10 and probably with the ANAX2-S100A10 heterotetramer. The interaction with S100A10 is required for the trafficking to the plasma membrane. Interacts with BSPRY. Interacts with calmodulin. SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-93520
Species: Hu
Applications: PEP-ELISA, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-93699
Species: Mu
Applications: ELISA, WB
NBP2-16661
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-50028
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P, WB
H00001594-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-86616
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-66778
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-74144
Species: Mu
Applications: WB
AF3320
Species: Hu
Applications: IHC, Simple Western, WB
MAB7665
Species: Hu
Applications: IHC, WB
NBP1-85495
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-97417
Species: Hu, In, Mu, Pm, Rt
Applications: ICC/IF, IF, IHC (-), WB
NBP3-21886
Species: Hu, Mu, Rt
Applications: WB
NB110-74960
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for TRPV6 Antibody (NBP2-32372)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: IF/IHC.


Filter By Application
IF/IHC
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for TRPV6 Antibody (NBP2-32372) (0)

There are no reviews for TRPV6 Antibody (NBP2-32372). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRPV6 Antibody (NBP2-32372) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRPV6 Products

Research Areas for TRPV6 Antibody (NBP2-32372)

Find related products by research area.

Blogs on TRPV6.

Winter is coming, and TRPM8 welcomes the cold!
TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds.  While TRPM8 is best known for its location in peripheral nerve endings, it has functio...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRPV6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPV6