TRPV6 Antibody

Immunohistochemistry: TRPV6 Antibody [NBP2-32372] - Time-course analysis of immunohistochemical staining of formalin-fixed intestinal sections for anti-TRPV6 from rats fed control, HP-LCa2+ , and HP-HCa2+ diets for 12 weeks. The relative positive area was quantified from the immunohistochemical staining of intestinal sections for anti-TRPV6 using ImageJ software. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32271147/) licensed under a CC-BY license.

Immunohistochemistry-Paraffin: TRPV6 Antibody [NBP2-32372] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.

Immunohistochemistry-Paraffin: TRPV6 Antibody [NBP2-32372] - Staining of human testis shows strong cytoplasmic and membranous positivity in Sertoli cells.

Immunohistochemistry-Paraffin: TRPV6 Antibody [NBP2-32372] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: TRPV6 Antibody [NBP2-32372] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Discontinued

TRPV6 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SPHLSLPMPSVSRSTSRSSANWERLRQGTLRRDLRGIINRGLEDGESWEYQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRPV6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%). Use in Rat reported in scientific literature (PMID:32271147).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TRPV6 Antibody

• ABP/ZF
• calcium channel CaT1
• Calcium transport protein 1
• CaT1
• CATL
• CaT-L
• CaT-like
• ECAC2
• ECAC2caT-L
• epithelial apical membrane calcium transporter/channel CaT1
• Epithelial calcium channel 2Alu-binding protein with zinc finger domain
• HSA277909
• LP6728
• transient receptor potential cation channel subfamily V member 6
• transient receptor potential cation channel, subfamily V, member 6
• TRPV6
• ZFAB

Background

Calcium-permeable channels, such as TRPV6, participate in neurotransmission, muscle contraction, and exocytosis by providing calcium as an intracellular second messenger. Depending on the tissue, transcellular calcium transport may be regulated by vitamin D, parathyroid hormone (PTH), or calcitonin (CALCA); FUNCTION: Calcium selective cation channel probably involved in Ca(2+) uptake in various tissues, including Ca(2+) reabsorption in intestine. The channel is activated by low internal calcium level, probably including intracellular calcium store depletion, and the current exhibits an inward rectification. Inactivation includes both, a rapid Ca(2+)-dependent and a slower Ca(2+)-calmodulin-dependent mechanism, the latter may be regulated by phosphorylation. In vitro, is slowly inhibited by Mg(2+) in a voltage-independent manner. Heteromeric assembly with TRPV5 seems to modify channel properties. TRPV5-TRPV6 heteromultimeric concatemers exhibit voltage-dependent gating. SUBUNIT: Homotetramer and probably heterotetramer with TRPV5. Interacts with TRPV5. Interacts with S100A10 and probably with the ANAX2-S100A10 heterotetramer. The interaction with S100A10 is required for the trafficking to the plasma membrane. Interacts with BSPRY. Interacts with calmodulin. SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TRPV6 Antibody (NBP2-32372)(1)

Publication using NBP2-32372

• Kim O H, Booth C J et al. High-phytate/low-calcium diet is a risk factor for crystal nephropathies, renal phosphate wasting, and bone loss. Elife 2020-09-04 [PMID: 32271147] (IF/IHC, Rat)

Bioinformatics

• Gene Symbol: TRPV6