TRPV6 Antibody


Immunohistochemistry-Paraffin: TRPV6 Antibody [NBP2-32372] - Staining of human placenta shows cytoplasmic positivity in decidua cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

TRPV6 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SPHLSLPMPSVSRSTSRSSANWERLRQGTLRRDLRGIINRGLEDGESWEYQ
Specificity of human TRPV6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRPV6 Recombinant Protein Antigen (NBP2-32372PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (80%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TRPV6 Antibody

  • ABP/ZF
  • calcium channel CaT1
  • Calcium transport protein 1
  • CaT1
  • CATL
  • CaT-L
  • CaT-like
  • ECAC2
  • ECAC2caT-L
  • epithelial apical membrane calcium transporter/channel CaT1
  • Epithelial calcium channel 2Alu-binding protein with zinc finger domain
  • HSA277909
  • LP6728
  • transient receptor potential cation channel subfamily V member 6
  • transient receptor potential cation channel, subfamily V, member 6
  • TRPV6
  • ZFAB


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, DirELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for TRPV6 Antibody (NBP2-32372) (0)

There are no publications for TRPV6 Antibody (NBP2-32372).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRPV6 Antibody (NBP2-32372) (0)

There are no reviews for TRPV6 Antibody (NBP2-32372). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRPV6 Antibody (NBP2-32372) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TRPV6 Products

Bioinformatics Tool for TRPV6 Antibody (NBP2-32372)

Discover related pathways, diseases and genes to TRPV6 Antibody (NBP2-32372). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRPV6 Antibody (NBP2-32372)

Discover more about diseases related to TRPV6 Antibody (NBP2-32372).

Pathways for TRPV6 Antibody (NBP2-32372)

View related products by pathway.

PTMs for TRPV6 Antibody (NBP2-32372)

Learn more about PTMs related to TRPV6 Antibody (NBP2-32372).

Research Areas for TRPV6 Antibody (NBP2-32372)

Find related products by research area.

Blogs on TRPV6.

Winter is coming, and TRPM8 welcomes the cold!
TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds.  While TRPM8 is best known for its location in peripheral nerve endings, it has functio...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TRPV6 Antibody and receive a gift card or discount.


Gene Symbol TRPV6