TRPC5 Antibody (1C8) - Azide and BSA Free

Western Blot: TRPC5 Antibody (1C8) [H00007224-M10] - Analysis of TRPC5 expression in transfected 293T cell line by TRPC5 monoclonal antibody (M10), clone 1C8. Lane 1: TRPC5 transfected lysate (Predicted MW: 111.4 KDa). Lane 2: Non-transfected lysate.

ELISA: TRPC5 Antibody (1C8) [H00007224-M10] - Detection limit for recombinant GST tagged TRPC5 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1C8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TRPC5 Antibody (1C8) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: TRPC5 (NP_036603, 534 a.a. ~ 603 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GLNQLYFYYETRAIDEPNNCKGIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGAT
• Specificity: This product is specific for Human TRPC5 monoclonal antibody (M10), clone 1C8 [Gene ID: 7224].
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TRPC5
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRPC5 Antibody (1C8) - Azide and BSA Free

• hTRP5
• hTRP-5
• short transient receptor potential channel 5
• transient receptor potential cation channel, subfamily C, member 5
• Transient receptor protein 5
• TRP5
• TRP-5
• TRP5transient receptor potential channel 5
• TRPC5

Background

TRPC5 is expressed in brain and is thought to form a receptor-activated non-selective calcium permeant cation channel. It is likely that the channel is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. It may also be activated by intracellular calcium store depletion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRPC5
• Uniprot:
  • NP_036603(Human)